P62678 · MTB_TREBE
- ProteinMetallothionein B
- Genemtb
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Metallothioneins have a high content of cysteine residues that bind various heavy metals.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 4 | a divalent metal cation 1 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 6 | a divalent metal cation 1 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 6 | a divalent metal cation 2 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 12 | a divalent metal cation 2 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 14 | a divalent metal cation 2 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 14 | a divalent metal cation 3 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 18 | a divalent metal cation 3 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 20 | a divalent metal cation 1 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 23 | a divalent metal cation 1 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 23 | a divalent metal cation 3 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 25 | a divalent metal cation 2 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 28 | a divalent metal cation 3 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 32 | a divalent metal cation 4 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 33 | a divalent metal cation 4 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 33 | a divalent metal cation 5 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 35 | a divalent metal cation 5 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 36 | a divalent metal cation 5 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 36 | a divalent metal cation 6 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 40 | a divalent metal cation 6 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 43 | a divalent metal cation 4 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 43 | a divalent metal cation 6 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 47 | a divalent metal cation 4 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 49 | a divalent metal cation 5 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 49 | a divalent metal cation 7 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 54 | a divalent metal cation 7 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 58 | a divalent metal cation 7 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 59 | a divalent metal cation 6 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 59 | a divalent metal cation 7 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | metal ion binding |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended nameMetallothionein B
- Short namesMT-B; MT-II
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Neoteleostei > Acanthomorphata > Eupercaria > Perciformes > Notothenioidei > Nototheniidae > Trematomus
Accessions
- Primary accessionP62678
- Secondary accessions
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000197301 | 1-60 | Metallothionein B | |||
Sequence: MDPCECSKSGTCNCGGSCTCTNCSCTSCKKSCCPCCPSGCTKCASGCVCKGKTCDTSCCQ |
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-28 | Beta | ||||
Sequence: MDPCECSKSGTCNCGGSCTCTNCSCTSC | ||||||
Region | 29-60 | Alpha | ||||
Sequence: KKSCCPCCPSGCTKCASGCVCKGKTCDTSCCQ |
Domain
Class I metallothioneins contain 2 metal-binding domains: four divalent ions are chelated within cluster A of the alpha domain and are coordinated via cysteinyl thiolate bridges to 11 cysteine ligands. Cluster B, the corresponding region within the beta domain, can ligate three divalent ions to 9 cysteines.
Sequence similarities
Belongs to the metallothionein superfamily. Type 1 family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length60
- Mass (Da)5,992
- Last updated2004-07-19 v1
- ChecksumE866F4AD61BC424A