P62191 · PRS4_HUMAN
- Protein26S proteasome regulatory subunit 4
- GenePSMC1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids440 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Features
Showing features for binding site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | membrane | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | proteasome accessory complex | |
Cellular Component | proteasome complex | |
Cellular Component | proteasome regulatory particle, base subcomplex | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | proteasome-activating activity | |
Molecular Function | RNA binding | |
Biological Process | proteasome-mediated ubiquitin-dependent protein catabolic process |
Keywords
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended name26S proteasome regulatory subunit 4
- Short namesP26s4
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP62191
- Secondary accessions
Proteomes
Organism-specific databases
Disease & Variants
Involvement in disease
Birk-Aharoni syndrome (BKAH)
- Note
- DescriptionAn autosomal recessive disorder characterized by failure to thrive, severe developmental delay, intellectual disability, spastic tetraplegia with central hypotonia, chorea, hearing loss, micropenis and undescended testes, as well as mild elevation of liver enzymes.
- See alsoMIM:620071
Natural variants in BKAH
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_087793 | 328 | I>T | in BKAH; uncertain significance; contrary to the wild type, it fails to rescue eye defects in Rpt2-null Drosophila |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_087793 | 328 | in BKAH; uncertain significance; contrary to the wild type, it fails to rescue eye defects in Rpt2-null Drosophila | |||
Sequence: I → T |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 224 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for initiator methionine, lipidation, chain, modified residue, modified residue (large scale data), cross-link.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Initiator methionine | 1 | UniProt | Removed | ||||
Sequence: M | |||||||
Lipidation | 2 | UniProt | N-myristoyl glycine | ||||
Sequence: G | |||||||
Chain | PRO_0000084677 | 2-440 | UniProt | 26S proteasome regulatory subunit 4 | |||
Sequence: GQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL | |||||||
Modified residue | 4 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 53 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 53 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Cross-link | 237 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | |||||||
Modified residue | 258 | UniProt | N6-acetyllysine | ||||
Sequence: K | |||||||
Modified residue | 434 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 434 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 439 | UniProt | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 439 | PRIDE | Phosphotyrosine | ||||
Sequence: Y |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts with SCA7 (PubMed:11734547).
Interacts with NGLY1 (PubMed:15358861).
Interacts with PAAF1 (PubMed:15831487).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P62191 | KDM1A O60341 | 2 | EBI-357598, EBI-710124 | |
BINARY | P62191 | LNX1 Q8TBB1 | 3 | EBI-357598, EBI-739832 | |
BINARY | P62191 | MAGEA2B P43356 | 3 | EBI-357598, EBI-5650739 | |
BINARY | P62191 | MEOX2 P50222 | 3 | EBI-357598, EBI-748397 | |
BINARY | P62191 | PAX4 Q3KNR5 | 3 | EBI-357598, EBI-10240813 | |
BINARY | P62191 | PSMC2 P35998 | 9 | EBI-357598, EBI-359710 | |
BINARY | P62191 | PSMC4 P43686 | 5 | EBI-357598, EBI-743997 | |
BINARY | P62191 | PSMC6 P62333 | 8 | EBI-357598, EBI-357669 | |
BINARY | P62191 | PSMD2 Q13200 | 19 | EBI-357598, EBI-357648 | |
BINARY | P62191 | PSMD4 P55036 | 5 | EBI-357598, EBI-359318 | |
BINARY | P62191 | PSMD5 Q16401 | 14 | EBI-357598, EBI-752143 | |
BINARY | P62191 | SNCA P37840 | 3 | EBI-357598, EBI-985879 | |
BINARY | P62191 | SOD1 P00441 | 5 | EBI-357598, EBI-990792 | |
BINARY | P62191 | SUV39H1 O43463 | 2 | EBI-357598, EBI-349968 | |
BINARY | P62191 | VCP P55072 | 3 | EBI-357598, EBI-355164 | |
BINARY | P62191 | ZBTB8A Q96BR9 | 3 | EBI-357598, EBI-742740 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-49 | Disordered | ||||
Sequence: MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKL | ||||||
Compositional bias | 12-33 | Basic and acidic residues | ||||
Sequence: GGGKKDDKDKKKKYEPPVPTRV | ||||||
Compositional bias | 84-102 | Basic and acidic residues | ||||
Sequence: QMKPLEEKQEEERSKVDDL | ||||||
Region | 84-104 | Disordered | ||||
Sequence: QMKPLEEKQEEERSKVDDLRG |
Sequence similarities
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P62191-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length440
- Mass (Da)49,185
- Last updated2004-06-21 v1
- ChecksumACA80782F4F96F49
P62191-2
- Name2
- Differences from canonical
- 1-73: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
G3V4X1 | G3V4X1_HUMAN | PSMC1 | 84 |
Features
Showing features for alternative sequence, compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_055768 | 1-73 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 12-33 | Basic and acidic residues | ||||
Sequence: GGGKKDDKDKKKKYEPPVPTRV | ||||||
Sequence conflict | 19 | in Ref. 1; AAA35484 | ||||
Sequence: K → E | ||||||
Sequence conflict | 70 | in Ref. 5; AAH67741 | ||||
Sequence: D → G | ||||||
Compositional bias | 84-102 | Basic and acidic residues | ||||
Sequence: QMKPLEEKQEEERSKVDDL | ||||||
Sequence conflict | 120 | in Ref. 5; AAH16368 | ||||
Sequence: H → R |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L02426 EMBL· GenBank· DDBJ | AAA35484.1 EMBL· GenBank· DDBJ | mRNA | ||
AK299121 EMBL· GenBank· DDBJ | BAG61175.1 EMBL· GenBank· DDBJ | mRNA | ||
CR457044 EMBL· GenBank· DDBJ | CAG33325.1 EMBL· GenBank· DDBJ | mRNA | ||
AL161662 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL355074 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC000512 EMBL· GenBank· DDBJ | AAH00512.1 EMBL· GenBank· DDBJ | mRNA | ||
BC016368 EMBL· GenBank· DDBJ | AAH16368.1 EMBL· GenBank· DDBJ | mRNA | ||
BC067741 EMBL· GenBank· DDBJ | AAH67741.1 EMBL· GenBank· DDBJ | mRNA | ||
BC073818 EMBL· GenBank· DDBJ | AAH73818.1 EMBL· GenBank· DDBJ | mRNA |