P61962 · DCAF7_HUMAN
- ProteinDDB1- and CUL4-associated factor 7
- GeneDCAF7
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids342 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in craniofacial development. Acts upstream of the EDN1 pathway and is required for formation of the upper jaw equivalent, the palatoquadrate. The activity required for EDN1 pathway function differs between the first and second arches (By similarity).
Associates with DIAPH1 and controls GLI1 transcriptional activity. Could be involved in normal and disease skin development. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex
Associates with DIAPH1 and controls GLI1 transcriptional activity. Could be involved in normal and disease skin development. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex
Pathway
Protein modification; protein ubiquitination.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Cul4-RING E3 ubiquitin ligase complex | |
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | nuclear body | |
Cellular Component | nuclear matrix | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | protein-containing complex | |
Molecular Function | protein-macromolecule adaptor activity | |
Biological Process | protein ubiquitination |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDDB1- and CUL4-associated factor 7
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP61962
- Secondary accessions
Proteomes
Organism-specific databases
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 150 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000051425 | 1-342 | DDB1- and CUL4-associated factor 7 | |||
Sequence: MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV |
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts with DYRK1A, DYRK1B and DIAPH1. Interacts with DDB1. Interacts with ZNF703. Interacts with human adenovirus 5 E1A protein (PubMed:23864635).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P61962 | ATN1 Q86V38 | 3 | EBI-359808, EBI-11954292 | |
BINARY | P61962 | CASP6 P55212 | 3 | EBI-359808, EBI-718729 | |
BINARY | P61962 | DYRK1A Q13627 | 14 | EBI-359808, EBI-1053596 | |
BINARY | P61962 | DYRK1B Q9Y463 | 7 | EBI-359808, EBI-634187 | |
BINARY | P61962 | HIPK2 Q9H2X6 | 11 | EBI-359808, EBI-348345 | |
BINARY | P61962 | HTT P42858 | 10 | EBI-359808, EBI-466029 | |
BINARY | P61962 | KLK6 Q92876 | 3 | EBI-359808, EBI-2432309 | |
BINARY | P61962 | LAMP2 P13473-2 | 3 | EBI-359808, EBI-21591415 | |
BINARY | P61962 | MAP3K1 Q13233 | 7 | EBI-359808, EBI-49776 | |
BINARY | P61962 | PRKN O60260-5 | 3 | EBI-359808, EBI-21251460 | |
BINARY | P61962 | TARDBP Q13148 | 3 | EBI-359808, EBI-372899 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 6-52 | WD 1 | ||||
Sequence: KRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGL | ||||||
Repeat | 60-100 | WD 2 | ||||
Sequence: ICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRV | ||||||
Repeat | 108-150 | WD 3 | ||||
Sequence: ECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGL | ||||||
Repeat | 165-206 | WD 4 | ||||
Sequence: HVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDL | ||||||
Repeat | 213-252 | WD 5 | ||||
Sequence: TIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDV | ||||||
Repeat | 257-296 | WD 6 | ||||
Sequence: TPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDI | ||||||
Repeat | 303-342 | WD 7 | ||||
Sequence: IEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV |
Sequence similarities
Belongs to the WD repeat DCAF7 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P61962-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length342
- Mass (Da)38,926
- Last updated2004-06-07 v1
- Checksum794CC69A45D0CC7C
P61962-2
- Name2
- Differences from canonical
- 47-246: Missing
Computationally mapped potential isoform sequences
There are 9 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8I5QKQ1 | A0A8I5QKQ1_HUMAN | DCAF7 | 179 | ||
A0A8I5KQ63 | A0A8I5KQ63_HUMAN | DCAF7 | 272 | ||
A0A8I5KRG1 | A0A8I5KRG1_HUMAN | DCAF7 | 306 | ||
A0A8I5KTU5 | A0A8I5KTU5_HUMAN | DCAF7 | 289 | ||
A0A8I5KT41 | A0A8I5KT41_HUMAN | DCAF7 | 230 | ||
A0A8I5KX45 | A0A8I5KX45_HUMAN | DCAF7 | 65 | ||
A0A8I5KXF0 | A0A8I5KXF0_HUMAN | DCAF7 | 70 | ||
A0A8I5KY66 | A0A8I5KY66_HUMAN | DCAF7 | 96 | ||
A0A087WWI6 | A0A087WWI6_HUMAN | DCAF7 | 300 |
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_054015 | 47-246 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U94747 EMBL· GenBank· DDBJ | AAC18913.1 EMBL· GenBank· DDBJ | mRNA | ||
AK303212 EMBL· GenBank· DDBJ | BAG64301.1 EMBL· GenBank· DDBJ | mRNA | ||
AC113554 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471109 EMBL· GenBank· DDBJ | EAW94305.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471109 EMBL· GenBank· DDBJ | EAW94306.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC001264 EMBL· GenBank· DDBJ | AAH01264.1 EMBL· GenBank· DDBJ | mRNA |