P61371 · ISL1_HUMAN
- ProteinInsulin gene enhancer protein ISL-1
- GeneISL1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids349 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
DNA-binding transcriptional activator. Recognizes and binds to the consensus octamer binding site 5'-ATAATTAA-3' in promoter of target genes. Plays a fundamental role in the gene regulatory network essential for retinal ganglion cell (RGC) differentiation. Cooperates with the transcription factor POU4F2 to achieve maximal levels of expression of RGC target genes and RGC fate specification in the developing retina. Involved in the specification of motor neurons in cooperation with LHX3 and LDB1 (By similarity).
Binds to insulin gene enhancer sequences (By similarity).
Essential for heart development. Marker of one progenitor cell population that give rise to the outflow tract, right ventricle, a subset of left ventricular cells, and a large number of atrial cells as well, its function is required for these progenitors to contribute to the heart. Controls the expression of FGF and BMP growth factors in this cell population and is required for proliferation and survival of cells within pharyngeal foregut endoderm and adjacent splanchnic mesoderm as well as for migration of cardiac progenitors into the heart (By similarity).
Binds to insulin gene enhancer sequences (By similarity).
Essential for heart development. Marker of one progenitor cell population that give rise to the outflow tract, right ventricle, a subset of left ventricular cells, and a large number of atrial cells as well, its function is required for these progenitors to contribute to the heart. Controls the expression of FGF and BMP growth factors in this cell population and is required for proliferation and survival of cells within pharyngeal foregut endoderm and adjacent splanchnic mesoderm as well as for migration of cardiac progenitors into the heart (By similarity).
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 181-240 | Homeobox | ||||
Sequence: TTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRS |
GO annotations
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
The subsequence KRDYIRLYGIKCAKCSIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEFALREDGLFCRADHDVVERASLGAGDPL, which contains the LIM domain, shows transcriptional repressor activity in a high-throughput recruitment assay.
Names & Taxonomy
Protein names
- Recommended nameInsulin gene enhancer protein ISL-1
- Short namesIslet-1
Gene names
- Community suggested namesISL1
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP61371
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 368 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000075746 | 1-349 | UniProt | Insulin gene enhancer protein ISL-1 | |||
Sequence: MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFVRDGKTYCKRDYIRLYGIKCAKCSIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEFALREDGLFCRADHDVVERASLGAGDPLSPLHPARPLQMAAEPISARQPALRPHVHKQPEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRSIMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDFALQSDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASPIEA | |||||||
Modified residue (large scale data) | 148 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 221 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 261 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 263 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 269 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Ubiquitinated probably by WWP1 E3 ubiquitin ligase; ubiquitination is followed by protein degradation.
Phosphorylated.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in subsets of neurons of the adrenal medulla and dorsal root ganglion, inner nuclear and ganglion cell layers in the retina, the pineal and some regions of the brain.
Developmental stage
Expressed in the forming heart in the stage 9 embryo, in the myocardial trough, and then at stages 10 to 11, in the nondifferentiated mesodermal cells at the venous and arterial poles, as well as cells of the dorsal coelomic wall and ruptured mesocardium (at protein level).
Gene expression databases
Organism-specific databases
Interaction
Subunit
At neuronal promoters, displaces LDB1 from LHX3 LIM domain to form a ternary complex in which ISL1 contacts both LHX3 and LDB1; allosteric structural changes in the DNA binding domain of LHX3, induced by the ISL1:LHX3 interaction, may explain differences in sequence specificity of the different complexes. Interacts with LHX3. Interacts (via C-terminus) with POU4F2 (via C-terminus) isoform 1. Interacts with POU3F2. Interacts with POU4F3. Interacts (via N-terminal domain) with MLIP; the interaction represses ISL1 transactivator activity. Interacts with GCN5/KAT2A. Interactions of ISL1 with MLIP1 or KAT2A may be mutually exclusive (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P61371 | LDB1 Q86U70-2 | 7 | EBI-3906896, EBI-11979761 | |
BINARY | P61371 | LHX4 Q969G2 | 4 | EBI-3906896, EBI-2865388 | |
BINARY | P61371 | SSBP4 Q9BWG4 | 4 | EBI-3906896, EBI-744719 | |
BINARY | P61371 | SYNGAP1 Q96PV0 | 8 | EBI-3906896, EBI-2682386 | |
BINARY | P61371 | ZNF511 Q8NB15 | 7 | EBI-3906896, EBI-10269136 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 17-70 | LIM zinc-binding 1 | ||||
Sequence: CVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFVRDGKTYCKRD | ||||||
Domain | 79-133 | LIM zinc-binding 2 | ||||
Sequence: CAKCSIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEFALREDGLFCRADH | ||||||
Region | 262-291 | LIM-binding domain (LID) | ||||
Sequence: GTPMVAASPERHDGGLQANPVEVQSYQPPW | ||||||
Compositional bias | 312-341 | Polar residues | ||||
Sequence: VNFSEGGPGSNSTGSEVASMSSQLPDTPNS | ||||||
Region | 312-349 | Disordered | ||||
Sequence: VNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASPIEA |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length349
- Mass (Da)39,036
- Last updated2004-05-24 v1
- Checksum4DB82FD09154F404
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
D6RBJ1 | D6RBJ1_HUMAN | ISL1 | 326 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 312-341 | Polar residues | ||||
Sequence: VNFSEGGPGSNSTGSEVASMSSQLPDTPNS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
S70721 EMBL· GenBank· DDBJ | AAD14064.1 EMBL· GenBank· DDBJ | mRNA | ||
U07559 EMBL· GenBank· DDBJ | AAA81946.1 EMBL· GenBank· DDBJ | mRNA | ||
BC031213 EMBL· GenBank· DDBJ | AAH31213.1 EMBL· GenBank· DDBJ | mRNA |