P61225 · RAP2B_HUMAN
- ProteinRas-related protein Rap-2b
- GeneRAP2B
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids183 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. Involved in EGFR and CHRM3 signaling pathways through stimulation of PLCE1. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May regulate membrane vesiculation in red blood cells.
Catalytic activity
- GTP + H2O = GDP + H+ + phosphate
Features
Showing features for binding site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | bicellular tight junction | |
Cellular Component | cell-cell contact zone | |
Cellular Component | cytosol | |
Cellular Component | extracellular exosome | |
Cellular Component | membrane | |
Cellular Component | membrane raft | |
Cellular Component | plasma membrane | |
Cellular Component | recycling endosome membrane | |
Cellular Component | specific granule membrane | |
Cellular Component | tertiary granule membrane | |
Molecular Function | G protein activity | |
Molecular Function | GDP binding | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Molecular Function | protein domain specific binding | |
Biological Process | negative regulation of cell migration | |
Biological Process | platelet activation | |
Biological Process | platelet aggregation | |
Biological Process | positive regulation of protein autophosphorylation | |
Biological Process | Rap protein signal transduction | |
Biological Process | regulation of protein tyrosine kinase activity | |
Biological Process | signal transduction |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRas-related protein Rap-2b
- EC number
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP61225
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Recycling endosome membrane ; Lipid-anchor
Note: Associated with red blood cells-released vesicles.
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 133 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), lipidation, modified residue, propeptide.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000030215 | 1-180 | UniProt | Ras-related protein Rap-2b | |||
Sequence: MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSAC | |||||||
Modified residue (large scale data) | 66 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Lipidation | 176 | UniProt | S-palmitoyl cysteine | ||||
Sequence: C | |||||||
Lipidation | 177 | UniProt | S-palmitoyl cysteine | ||||
Sequence: C | |||||||
Modified residue | 180 | UniProt | Cysteine methyl ester | ||||
Sequence: C | |||||||
Lipidation | 180 | UniProt | S-geranylgeranyl cysteine | ||||
Sequence: C | |||||||
Propeptide | PRO_0000030216 | 181-183 | UniProt | Removed in mature form | |||
Sequence: VIL |
Post-translational modification
Palmitoylated. Unlike RAP2A and RAP2C, palmitoylation of RAP2B is not required for association with recycling endosome membranes and activation of TNIK.
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Interacts with PLCE1. Interacts with SGSM1, SGSM2 and SGSM3. The GTP-bound form of RAP2B interacts with RUNDC3A (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P61225 | CAMK2B Q13554 | 3 | EBI-750871, EBI-1058722 | |
BINARY | P61225 | CAMK2B Q13554-3 | 3 | EBI-750871, EBI-11523526 | |
BINARY | P61225 | RAP1GDS1 P52306-5 | 3 | EBI-750871, EBI-12832744 | |
BINARY | P61225 | RASSF5 Q8WWW0 | 3 | EBI-750871, EBI-367390 | |
BINARY | P61225 | RUNDC3A Q59EK9 | 4 | EBI-750871, EBI-747225 | |
BINARY | P61225 | RUNDC3A Q59EK9-3 | 3 | EBI-750871, EBI-11957366 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 32-40 | Effector region | ||||
Sequence: YDPTIEDFY |
Domain
The effector domain mediates the interaction with RUNDC3A.
Sequence similarities
Belongs to the small GTPase superfamily. Ras family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length183
- Mass (Da)20,504
- Last updated2004-05-10 v1
- ChecksumA1139C2D5E7F5865
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 170 | in Ref. 1; CAA37178 and 2; no nucleotide entry | ||||
Sequence: P → S |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X52987 EMBL· GenBank· DDBJ | CAA37178.1 EMBL· GenBank· DDBJ | mRNA | ||
AF493915 EMBL· GenBank· DDBJ | AAM12629.1 EMBL· GenBank· DDBJ | mRNA | ||
BC012362 EMBL· GenBank· DDBJ | AAH12362.1 EMBL· GenBank· DDBJ | mRNA |