P61018 · RAB4B_HUMAN
- ProteinRas-related protein Rab-4B
- GeneRAB4B
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids213 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion (Probable). Mediates endosomal tethering and fusion through the interaction with RUFY1 and RAB14 (PubMed:20534812).
Acts as a regulator of platelet alpha-granule release during activation and aggregation of platelets (By similarity).
Acts as a regulator of platelet alpha-granule release during activation and aggregation of platelets (By similarity).
Catalytic activity
- GTP + H2O = GDP + H+ + phosphateThis reaction proceeds in the forward direction.
Activity regulation
Rab activation is generally mediated by a guanine exchange factor (GEF), while inactivation through hydrolysis of bound GTP is catalyzed by a GTPase activating protein (GAP).
Features
Showing features for binding site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | early endosome membrane | |
Cellular Component | insulin-responsive compartment | |
Cellular Component | perinuclear region of cytoplasm | |
Cellular Component | plasma membrane | |
Cellular Component | recycling endosome | |
Cellular Component | secretory granule membrane | |
Molecular Function | G protein activity | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Biological Process | early endosome to Golgi transport | |
Biological Process | endosomal vesicle fusion | |
Biological Process | glucose import | |
Biological Process | protein transport | |
Biological Process | Rab protein signal transduction | |
Biological Process | regulation of endocytosis | |
Biological Process | vesicle-mediated transport |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRas-related protein Rab-4B
- EC number
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP61018
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Lipid-anchor
Early endosome membrane ; Lipid-anchor
Keywords
- Cellular component
Disease & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 67 | GTP-locked. Interacts with RUFY1. | ||||
Sequence: Q → L |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 269 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain, modified residue (large scale data), lipidation.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Initiator methionine | 1 | UniProt | Removed | ||||
Sequence: M | |||||||
Modified residue | 2 | UniProt | N-acetylalanine | ||||
Sequence: A | |||||||
Chain | PRO_0000121099 | 2-213 | UniProt | Ras-related protein Rab-4B | |||
Sequence: AETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCGNKKDLDPEREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILNKIDSGELDPERMGSGIQYGDASLRQLRQPRSAQAVAPQPCGC | |||||||
Modified residue | 67 | UniProt | 5-glutamyl serotonin | ||||
Sequence: Q | |||||||
Modified residue | 185 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 193 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 193 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Lipidation | 211 | UniProt | S-geranylgeranyl cysteine | ||||
Sequence: C | |||||||
Modified residue | 213 | UniProt | Cysteine methyl ester | ||||
Sequence: C | |||||||
Lipidation | 213 | UniProt | S-geranylgeranyl cysteine | ||||
Sequence: C |
Post-translational modification
Serotonylation of Gln-67 by TGM2 during activation and aggregation of platelets leads to constitutive activation of GTPase activity.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts (GTP-bound form) with RUFY1; the interaction allows endosomal tethering and fusion.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P61018 | BOLA2-SMG1P6 A0A087WZT3 | 3 | EBI-10218066, EBI-12006120 | |
BINARY | P61018 | CDC45 O75419 | 3 | EBI-10218066, EBI-374969 | |
BINARY | P61018 | EXOC5 O00471 | 6 | EBI-10218066, EBI-949824 | |
BINARY | P61018 | GARIN6 Q8NEG0 | 3 | EBI-10218066, EBI-752049 | |
BINARY | P61018 | RABEP1 Q15276 | 3 | EBI-10218066, EBI-447043 | |
BINARY | P61018 | VPS52 Q8N1B4 | 3 | EBI-10218066, EBI-2799833 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 37-45 | Effector region | ||||
Sequence: SNHTIGVEF |
Sequence similarities
Belongs to the small GTPase superfamily. Rab family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P61018-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length213
- Mass (Da)23,587
- Last updated2004-04-26 v1
- Checksum0C3D76DC3285DB98
P61018-2
- Name2
- Differences from canonical
- 1-5: MAETY → MSVSLPLTVMVRERDWIGIHLFSLYLSLPVGIPDFGSIWS
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_013567 | 1-5 | in isoform 2 | |||
Sequence: MAETY → MSVSLPLTVMVRERDWIGIHLFSLYLSLPVGIPDFGSIWS | ||||||
Sequence conflict | 4-6 | in Ref. 1; AAP97171 | ||||
Sequence: TYD → DRH |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF087861 EMBL· GenBank· DDBJ | AAP97171.1 EMBL· GenBank· DDBJ | mRNA | ||
AF165522 EMBL· GenBank· DDBJ | AAD45923.1 EMBL· GenBank· DDBJ | mRNA | ||
AF217985 EMBL· GenBank· DDBJ | AAG17228.1 EMBL· GenBank· DDBJ | mRNA | ||
AF498935 EMBL· GenBank· DDBJ | AAM21083.1 EMBL· GenBank· DDBJ | mRNA | ||
BC046927 EMBL· GenBank· DDBJ | AAH46927.1 EMBL· GenBank· DDBJ | mRNA |