P60896 · SEM1_HUMAN
- Protein26S proteasome complex subunit SEM1
- GeneSEM1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair (PubMed:15117943).
Component of the TREX-2 complex (transcription and export complex 2), composed of at least ENY2, GANP, PCID2, SEM1, and either centrin CETN2 or CETN3 (PubMed:22307388).
The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery. Binds and stabilizes BRCA2 and is thus involved in the control of R-loop-associated DNA damage and thus transcription-associated genomic instability. R-loop accumulation increases in SEM1-depleted cells
Component of the TREX-2 complex (transcription and export complex 2), composed of at least ENY2, GANP, PCID2, SEM1, and either centrin CETN2 or CETN3 (PubMed:22307388).
The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery. Binds and stabilizes BRCA2 and is thus involved in the control of R-loop-associated DNA damage and thus transcription-associated genomic instability. R-loop accumulation increases in SEM1-depleted cells
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | integrator complex | |
Cellular Component | nucleoplasm | |
Cellular Component | proteasome complex | |
Cellular Component | proteasome regulatory particle, lid subcomplex | |
Cellular Component | protein-containing complex | |
Biological Process | double-strand break repair via homologous recombination | |
Biological Process | mRNA export from nucleus | |
Biological Process | proteasome assembly | |
Biological Process | proteasome-mediated ubiquitin-dependent protein catabolic process |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended name26S proteasome complex subunit SEM1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP60896
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_012003 | 17 | in dbSNP:rs1802882 | |||
Sequence: D → G |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 68 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000122961 | 1-70 | 26S proteasome complex subunit SEM1 | |||
Sequence: MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in limb bud, craniofacial primordia and skin.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Component of the 19S proteasome regulatory particle complex. The 26S proteasome consists of a 20S core particle (CP) and two 19S regulatory subunits (RP). The regulatory particle is made of a lid composed of 9 subunits including SEM1, a base containing 6 ATPases and few additional components (PubMed:27342858, PubMed:27428775).
Belongs to the TREX-2 complex (transcription and export complex 2), composed of at least ENY2, GANP, PCID2, SEM1, and either centrin CETN2 or CETN3 (PubMed:22307388).
Component of the homologous recombination repair (HR) complex composed of ERCC5/XPG, BRCA2, PALB2, DSS1 and RAD51 (PubMed:26833090).
Interacts with the C-terminal of BRCA2 (PubMed:10373512, PubMed:21719596).
Belongs to the TREX-2 complex (transcription and export complex 2), composed of at least ENY2, GANP, PCID2, SEM1, and either centrin CETN2 or CETN3 (PubMed:22307388).
Component of the homologous recombination repair (HR) complex composed of ERCC5/XPG, BRCA2, PALB2, DSS1 and RAD51 (PubMed:26833090).
Interacts with the C-terminal of BRCA2 (PubMed:10373512, PubMed:21719596).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P60896 | BRCA2 P51587 | 10 | EBI-79819, EBI-79792 | |
BINARY | P60896 | DR1 Q01658 | 3 | EBI-79819, EBI-750300 | |
BINARY | P60896 | FUS P35637 | 3 | EBI-79819, EBI-400434 | |
BINARY | P60896 | GRN P28799 | 3 | EBI-79819, EBI-747754 | |
BINARY | P60896 | GTF2B Q00403 | 3 | EBI-79819, EBI-389564 | |
BINARY | P60896 | GTF3C3 Q9Y5Q9 | 3 | EBI-79819, EBI-1054873 | |
BINARY | P60896 | JPH3 Q8WXH2 | 3 | EBI-79819, EBI-1055254 | |
BINARY | P60896 | LRRK2 Q5S007 | 3 | EBI-79819, EBI-5323863 | |
BINARY | P60896 | NF2 P35240-4 | 3 | EBI-79819, EBI-1014514 | |
BINARY | P60896 | PCID2 Q5JVF3 | 4 | EBI-79819, EBI-1051701 | |
BINARY | P60896 | PCID2 Q5JVF3-1 | 3 | EBI-79819, EBI-15970419 | |
BINARY | P60896 | PSMD3 O43242 | 4 | EBI-79819, EBI-357622 | |
BINARY | P60896 | SOD1 P00441 | 3 | EBI-79819, EBI-990792 | |
BINARY | P60896 | SPTLC1 Q6NUL7 | 3 | EBI-79819, EBI-25912847 |
Protein-protein interaction databases
Structure
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative promoter usage.
P60896-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length70
- Mass (Da)8,278
- Last updated2004-04-13 v1
- Checksum0E0F58D2F3D9F723
Q6ZVN7-1
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- Name2
Computationally mapped potential isoform sequences
There are 12 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q6ZVN7 | SEML_HUMAN | SEM1 | 128 | ||
A0A096LP17 | A0A096LP17_HUMAN | SEM1 | 57 | ||
A0A096LP28 | A0A096LP28_HUMAN | SEM1 | 120 | ||
B7ZVW6 | B7ZVW6_HUMAN | SEM1 | 118 | ||
A0A087X1V0 | A0A087X1V0_HUMAN | SEM1 | 89 | ||
A0A087X261 | A0A087X261_HUMAN | SEM1 | 58 | ||
A0A087WUG5 | A0A087WUG5_HUMAN | SEM1 | 30 | ||
A0A087WXB9 | A0A087WXB9_HUMAN | SEM1 | 61 | ||
A0A087WYU0 | A0A087WYU0_HUMAN | SEM1 | 66 | ||
F2Z2L7 | F2Z2L7_HUMAN | SEM1 | 62 | ||
F2Z2N6 | F2Z2N6_HUMAN | SEM1 | 65 | ||
F2Z309 | F2Z309_HUMAN | SEM1 | 89 |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U41515 EMBL· GenBank· DDBJ | AAA91179.1 EMBL· GenBank· DDBJ | mRNA | ||
AC073230 EMBL· GenBank· DDBJ | AAQ93368.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC032782 EMBL· GenBank· DDBJ | AAH32782.1 EMBL· GenBank· DDBJ | mRNA |