P60371 · KR106_HUMAN
- ProteinKeratin-associated protein 10-6
- GeneKRTAP10-6
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids365 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | keratin filament |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameKeratin-associated protein 10-6
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP60371
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_060049 | 68 | in dbSNP:rs13051409 | |||
Sequence: C → S | ||||||
Natural variant | VAR_060050 | 74 | in dbSNP:rs13050443 | |||
Sequence: P → S | ||||||
Natural variant | VAR_017699 | 81 | ||||
Sequence: C → CPSCCA | ||||||
Natural variant | VAR_057649 | 159 | in dbSNP:rs233306 | |||
Sequence: V → I | ||||||
Natural variant | VAR_062533 | 300 | in dbSNP:rs465279 | |||
Sequence: S → P |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 653 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000185214 | 1-365 | Keratin-associated protein 10-6 | |||
Sequence: MAASTMSVCSSDLSYGSRVCLPGSCDSCSDSWQVDDCPESCCEPPCCAPAPCLSLVCTPVSRVSSPCCPVTCEPSPCQSGCTSSCTPSCCQQSSCQLACCASSPCQQACCVPVCCKTVCCKPVCCVSVCCGDSSCCQQSSCQSACCTSSPCQQACCVPVCCKPVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGCTSSCTPSCCQQSSCQPTCCTSSPCQQACCVPVCCVPVCCVPTCSEDSSSCCQQSSCQPACCTSSPCQHACCVPVCSGASTSCCQQSSCQPACCTASCCRSSSSVSLLCHPVCKSTCCVPVPSCGASASSCQPSCCRTASCVSLLCRPMCSRPACYSLCSGQKSSC |
Proteomic databases
PTM databases
Interaction
Subunit
Interacts with hair keratins.
Binary interactions
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for repeat, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 41-45 | 1 | ||||
Sequence: CCEPP | ||||||
Region | 41-338 | 29 X 5 AA repeats of C-C-X3 | ||||
Sequence: CCEPPCCAPAPCLSLVCTPVSRVSSPCCPVTCEPSPCQSGCTSSCTPSCCQQSSCQLACCASSPCQQACCVPVCCKTVCCKPVCCVSVCCGDSSCCQQSSCQSACCTSSPCQQACCVPVCCKPVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGCTSSCTPSCCQQSSCQPTCCTSSPCQQACCVPVCCVPVCCVPTCSEDSSSCCQQSSCQPACCTSSPCQHACCVPVCSGASTSCCQQSSCQPACCTASCCRSSSSVSLLCHPVCKSTCCVPVPSCGASASSCQPSCCRTA | ||||||
Repeat | 46-50 | 2 | ||||
Sequence: CCAPA | ||||||
Repeat | 67-71 | 3 | ||||
Sequence: CCPVT | ||||||
Repeat | 89-93 | 4 | ||||
Sequence: CCQQS | ||||||
Repeat | 99-103 | 5 | ||||
Sequence: CCASS | ||||||
Repeat | 109-113 | 6 | ||||
Sequence: CCVPV | ||||||
Repeat | 114-118 | 7 | ||||
Sequence: CCKTV | ||||||
Repeat | 119-123 | 8 | ||||
Sequence: CCKPV | ||||||
Repeat | 124-128 | 9 | ||||
Sequence: CCVSV | ||||||
Repeat | 129-133 | 10 | ||||
Sequence: CCGDS | ||||||
Repeat | 135-139 | 11 | ||||
Sequence: CCQQS | ||||||
Repeat | 145-149 | 12 | ||||
Sequence: CCTSS | ||||||
Repeat | 155-159 | 13 | ||||
Sequence: CCVPV | ||||||
Repeat | 160-164 | 14 | ||||
Sequence: CCKPV | ||||||
Repeat | 172-176 | 15 | ||||
Sequence: CCQQS | ||||||
Repeat | 186-190 | 16 | ||||
Sequence: CCQAV | ||||||
Repeat | 208-212 | 17 | ||||
Sequence: CCQQS | ||||||
Repeat | 218-222 | 18 | ||||
Sequence: CCTSS | ||||||
Repeat | 228-232 | 19 | ||||
Sequence: CCVPV | ||||||
Repeat | 233-237 | 20 | ||||
Sequence: CCVPV | ||||||
Repeat | 238-242 | 21 | ||||
Sequence: CCVPT | ||||||
Repeat | 250-254 | 22 | ||||
Sequence: CCQQS | ||||||
Repeat | 260-264 | 23 | ||||
Sequence: CCTSS | ||||||
Repeat | 270-274 | 24 | ||||
Sequence: CCVPV | ||||||
Repeat | 282-286 | 25 | ||||
Sequence: CCQQS | ||||||
Repeat | 292-296 | 26 | ||||
Sequence: CCTAS | ||||||
Repeat | 297-301 | 27 | ||||
Sequence: CCRSS | ||||||
Repeat | 316-320 | 28 | ||||
Sequence: CCVPV | ||||||
Repeat | 334-338 | 29 | ||||
Sequence: CCRTA |
Sequence similarities
Belongs to the KRTAP type 10 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length365
- Mass (Da)36,781
- Last updated2022-02-23 v3
- Checksum480DC12200716EA2
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB076353 EMBL· GenBank· DDBJ | BAD01540.1 EMBL· GenBank· DDBJ | mRNA | ||
AL773602 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |