P60059 · SC61G_HUMAN
- ProteinProtein transport protein Sec61 subunit gamma
- GeneSEC61G
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of SEC61 channel-forming translocon complex that mediates transport of signal peptide-containing precursor polypeptides across the endoplasmic reticulum (ER) (By similarity).
Forms a ribosome receptor and a gated pore in the ER membrane, both functions required for cotranslational translocation of nascent polypeptides (By similarity).
The SEC61 channel is also involved in ER membrane insertion of transmembrane proteins: it mediates membrane insertion of the first few transmembrane segments of proteins, while insertion of subsequent transmembrane regions of multi-pass membrane proteins is mediated by the multi-pass translocon (MPT) complex (PubMed:32820719, PubMed:36261522).
The SEC61 channel cooperates with the translocating protein TRAM1 to import nascent proteins into the ER (By similarity).
Forms a ribosome receptor and a gated pore in the ER membrane, both functions required for cotranslational translocation of nascent polypeptides (By similarity).
The SEC61 channel is also involved in ER membrane insertion of transmembrane proteins: it mediates membrane insertion of the first few transmembrane segments of proteins, while insertion of subsequent transmembrane regions of multi-pass membrane proteins is mediated by the multi-pass translocon (MPT) complex (PubMed:32820719, PubMed:36261522).
The SEC61 channel cooperates with the translocating protein TRAM1 to import nascent proteins into the ER (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | membrane | |
Cellular Component | Ssh1 translocon complex | |
Molecular Function | protein transmembrane transporter activity | |
Molecular Function | ribosome binding | |
Biological Process | post-translational protein targeting to membrane, translocation | |
Biological Process | protein targeting to ER |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameProtein transport protein Sec61 subunit gamma
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP60059
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Single-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-32 | Cytoplasmic | ||||
Sequence: MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKE | ||||||
Transmembrane | 33-61 | Helical | ||||
Sequence: FQKIAMATAIGFAIMGFIGFFVKLIHIPI | ||||||
Topological domain | 62-68 | Extracellular | ||||
Sequence: NNIIVGG |
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 67 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Modified residue | 1 | N-acetylmethionine | ||||
Sequence: M | ||||||
Chain | PRO_0000104195 | 1-68 | Protein transport protein Sec61 subunit gamma | |||
Sequence: MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG | ||||||
Modified residue | 18 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
The SEC61 channel-forming translocon complex consists of channel-forming core components SEC61A1, SEC61B and SEC61G and different auxiliary components such as SEC62 and SEC63 (By similarity).
The SEC61 channel associates with the multi-pass translocon (MPT) complex (PubMed:32820719, PubMed:36261522).
The SEC61 channel associates with the multi-pass translocon (MPT) complex (PubMed:32820719, PubMed:36261522).
(Microbial infection) May interact with Zika virus strain Mr-766 non-structural protein 4A/NS4A (PubMed:30550790).
May interact with Zika virus French Polynesia 10087PF/2013 non-structural protein 4A/NS4A (PubMed:30550790).
May interact with Zika virus French Polynesia 10087PF/2013 non-structural protein 4A/NS4A (PubMed:30550790).
(Microbial infection) May interact with Dengue virus DENV2 16681 non-structural protein 4A/NS4A.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P60059 | AQP6 Q13520 | 3 | EBI-4402709, EBI-13059134 | |
BINARY | P60059 | CREB3L1 Q96BA8 | 5 | EBI-4402709, EBI-6942903 | |
BINARY | P60059 | FAM209A Q5JX71 | 3 | EBI-4402709, EBI-18304435 | |
BINARY | P60059 | LCN2 P80188 | 3 | EBI-4402709, EBI-11911016 | |
BINARY | P60059 | LRRC25 Q8N386 | 3 | EBI-4402709, EBI-11304917 | |
BINARY | P60059 | PEX12 O00623 | 3 | EBI-4402709, EBI-594836 | |
BINARY | P60059 | SFTPC P11686 | 3 | EBI-4402709, EBI-10197617 | |
BINARY | P60059 | TMEM51 Q9NW97 | 3 | EBI-4402709, EBI-726044 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length68
- Mass (Da)7,741
- Last updated2003-11-21 v1
- Checksum14C8279A22548561
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF054184 EMBL· GenBank· DDBJ | AAC99401.1 EMBL· GenBank· DDBJ | mRNA | ||
CR456979 EMBL· GenBank· DDBJ | CAG33260.1 EMBL· GenBank· DDBJ | mRNA | ||
AK311845 EMBL· GenBank· DDBJ | BAG34787.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471201 EMBL· GenBank· DDBJ | EAW50960.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC009480 EMBL· GenBank· DDBJ | AAH09480.1 EMBL· GenBank· DDBJ | mRNA | ||
BC051840 EMBL· GenBank· DDBJ | AAH51840.1 EMBL· GenBank· DDBJ | mRNA |