P59936 · KA121_TITSE
- ProteinPotassium channel toxin alpha-KTx 12.1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Potently blocks Kv1.3/KCNA3, Kv1.2/KCNA2, and Shaker potassium channels (PubMed:24590385) and inhibits high conductance calcium-activated potassium channels (PubMed:10082164).
Is potent against Kv1.3/KCNN3 (IC50=0.55 nM) and Kv1.2/KCNN2 (IC50=6.19 nM) (PubMed:24590385).
It also stimulates the release of NO, IL-6 and TNF-alpha in J774.1 cells and presents a pro-inflammatory activity in mice (PubMed:21549737, PubMed:23085190).
Is potent against Kv1.3/KCNN3 (IC50=0.55 nM) and Kv1.2/KCNN2 (IC50=6.19 nM) (PubMed:24590385).
It also stimulates the release of NO, IL-6 and TNF-alpha in J774.1 cells and presents a pro-inflammatory activity in mice (PubMed:21549737, PubMed:23085190).
Miscellaneous
The N-terminal C2-C5 disulfide bridge unique to this toxin does not appear to confer stability to the protein.
Negative results: inhibits with a low efficiency Kv1.1/KCNA1, Kv1.5/KCNA5, Kv1.6/KCNA6, Kv4.3/KCND3, Kv7.1/KCNQ1, Kv7.2/KCNQ2, Kv7.4/KCNQ4, and ERG/KCNH2, and does not inhibit Kv1.4/KCNA4, Kv2.1/KCNB1, and Kv3.1/KCNC1.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 52 | Basic residue of the functional dyad | ||||
Sequence: K | ||||||
Site | 61 | Aromatic residue of the functional dyad | ||||
Sequence: Y |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | ion channel inhibitor activity | |
Molecular Function | potassium channel regulator activity | |
Molecular Function | toxin activity |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended namePotassium channel toxin alpha-KTx 12.1
- Alternative names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Chelicerata > Arachnida > Scorpiones > Buthida > Buthoidea > Buthidae > Tityus
Accessions
- Primary accessionP59936
- Secondary accessions
Subcellular Location
Phenotypes & Variants
Toxic dose
LD50 is 826 ug/kg by intravenous injection into mice.
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MQVFYGLLLMFILCSTIHLSEQ | ||||||
Chain | PRO_0000066838 | 23-62 | Potassium channel toxin alpha-KTx 12.1 | |||
Sequence: WCSTCLDLACGASRECYDPCFKAFGRAHGKCMNNKCRCYT | ||||||
Disulfide bond | 24↔27 | |||||
Sequence: CSTC | ||||||
Disulfide bond | 32↔53 | |||||
Sequence: CGASRECYDPCFKAFGRAHGKC | ||||||
Disulfide bond | 38↔58 | |||||
Sequence: CYDPCFKAFGRAHGKCMNNKC | ||||||
Disulfide bond | 42↔60 | |||||
Sequence: CFKAFGRAHGKCMNNKCRC |
Keywords
- PTM
Expression
Tissue specificity
Expressed by the venom gland.
Structure
Family & Domains
Domain
Has the structural arrangement of an alpha-helix connected to a beta-sheet by disulfide bonds (CSalpha/beta).
Sequence similarities
Belongs to the short scorpion toxin superfamily. Potassium channel inhibitor family. Alpha-KTx 12 subfamily.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length62
- Mass (Da)7,083
- Last updated2022-08-03 v3
- Checksum73A73207EE885334
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 62 | in Ref. 4; AA sequence | ||||
Sequence: T → TN |
Mass Spectrometry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
GEUW01000052 EMBL· GenBank· DDBJ | JAW06993.1 EMBL· GenBank· DDBJ | mRNA | ||
GEUW01000010 EMBL· GenBank· DDBJ | JAW07035.1 EMBL· GenBank· DDBJ | mRNA | ||
MK159306 EMBL· GenBank· DDBJ | QCZ41150.1 EMBL· GenBank· DDBJ | mRNA | ||
MT450709 EMBL· GenBank· DDBJ | QPD99045.1 EMBL· GenBank· DDBJ | mRNA |