P57055 · DSCR6_HUMAN
- ProteinProtein ripply3
- GeneRIPPLY3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids190 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Acts as a transcriptional corepressor. Negative regulator of the transcriptional activity of TBX1. Plays a role in the development of the pharyngeal apparatus and derivatives (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Biological Process | cell population proliferation | |
Biological Process | embryonic pattern specification | |
Biological Process | heart development | |
Biological Process | negative regulation of cell population proliferation | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | pharyngeal system development |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein ripply3
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP57055
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 285 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000080020 | 1-190 | Protein ripply3 | |||
Sequence: MEPEAAAGARKARGRGCHCPGDAPWRPPPPRGPESPAPWRPWIQTPGDAELTRTGRPLEPRADQHTFGSKGAFGFQHPVRVYLPMSKRQEYLRSSGEQVLASFPVQATIDFYDDESTESASEAEEPEEGPPPLHLLPQEVGGRQENGPGGKGRDQGINQGQRSSGGGDHWGEGPLPQGVSSRGGKCSSSK |
Proteomic databases
PTM databases
Interaction
Subunit
Interacts with TBX1.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P57055 | CEP76 Q8TAP6 | 3 | EBI-12092053, EBI-742887 | |
BINARY | P57055 | INCA1 Q0VD86 | 3 | EBI-12092053, EBI-6509505 | |
BINARY | P57055 | MCRS1 Q96EZ8 | 4 | EBI-12092053, EBI-348259 | |
BINARY | P57055 | ORC2 Q13416 | 3 | EBI-12092053, EBI-374957 | |
BINARY | P57055 | PSMB1 P20618 | 3 | EBI-12092053, EBI-372273 | |
BINARY | P57055 | TBX1 O43435 | 3 | EBI-12092053, EBI-21460353 | |
BINARY | P57055 | TIFA Q96CG3 | 4 | EBI-12092053, EBI-740711 | |
BINARY | P57055 | TRAF2 Q12933 | 3 | EBI-12092053, EBI-355744 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for compositional bias, region, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-17 | Basic and acidic residues | ||||
Sequence: MEPEAAAGARKARGRGC | ||||||
Region | 1-72 | Disordered | ||||
Sequence: MEPEAAAGARKARGRGCHCPGDAPWRPPPPRGPESPAPWRPWIQTPGDAELTRTGRPLEPRADQHTFGSKGA | ||||||
Compositional bias | 22-40 | Pro residues | ||||
Sequence: DAPWRPPPPRGPESPAPWR | ||||||
Motif | 39-42 | WRPW motif | ||||
Sequence: WRPW | ||||||
Region | 77-112 | Ripply homology domain | ||||
Sequence: HPVRVYLPMSKRQEYLRSSGEQVLASFPVQATIDFY | ||||||
Region | 110-190 | Disordered | ||||
Sequence: DFYDDESTESASEAEEPEEGPPPLHLLPQEVGGRQENGPGGKGRDQGINQGQRSSGGGDHWGEGPLPQGVSSRGGKCSSSK |
Domain
The Ripply homology domain and the WRPW motif are both necessary for its transcriptional corepressor activity on the transcription activator TBX1.
The WRPW motif is required for binding to tle/groucho proteins.
Sequence similarities
Belongs to the ripply family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P57055-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsA
- Length190
- Mass (Da)20,368
- Last updated2000-12-01 v1
- ChecksumBF1C3EBD19375E1E
P57055-2
- Name2
- SynonymsB, C, D
- Differences from canonical
- 1-84: Missing
Features
Showing features for compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-17 | Basic and acidic residues | ||||
Sequence: MEPEAAAGARKARGRGC | ||||||
Alternative sequence | VSP_004205 | 1-84 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 22-40 | Pro residues | ||||
Sequence: DAPWRPPPPRGPESPAPWR |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB037158 EMBL· GenBank· DDBJ | BAA96867.1 EMBL· GenBank· DDBJ | mRNA | ||
AB037159 EMBL· GenBank· DDBJ | BAA96868.1 EMBL· GenBank· DDBJ | mRNA | ||
AB037160 EMBL· GenBank· DDBJ | BAA96869.1 EMBL· GenBank· DDBJ | mRNA | ||
AB037161 EMBL· GenBank· DDBJ | BAA96870.1 EMBL· GenBank· DDBJ | mRNA |