P56750 · CLD17_HUMAN
- ProteinClaudin-17
- GeneCLDN17
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids224 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Channel-forming tight junction protein with selectivity for anions, including chloride and hydrogencarbonate, and for solutes smaller than 9 Angstrom in diameter. In the kidney proximal tubule, may be involved in paracellular reabsorption of filtered anions. Does not affect water permeability.
Catalytic activity
- chloride(in) = chloride(out)
- hydrogencarbonate(in) = hydrogencarbonate(out)
- bromide(in) = bromide(out)
- iodide(out) = iodide(in)
- fluoride(in) = fluoride(out)
- nitrate(in) = nitrate(out)
- thiocyanate(in) = thiocyanate(out)
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | basolateral plasma membrane | |
Cellular Component | bicellular tight junction | |
Cellular Component | chloride channel complex | |
Cellular Component | plasma membrane | |
Cellular Component | tight junction | |
Molecular Function | channel activity | |
Molecular Function | chloride channel activity | |
Molecular Function | identical protein binding | |
Molecular Function | paracellular tight junction channel activity | |
Molecular Function | structural molecule activity | |
Biological Process | bicellular tight junction assembly | |
Biological Process | calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules | |
Biological Process | cell adhesion | |
Biological Process | paracellular transport |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameClaudin-17
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP56750
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Basolateral cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-7 | Cytoplasmic | ||||
Sequence: MAFYPLQ | ||||||
Transmembrane | 8-28 | Helical | ||||
Sequence: IAGLVLGFLGMVGTLATTLLP | ||||||
Topological domain | 29-81 | Extracellular | ||||
Sequence: QWRVSAFVGSNIIVFERLWEGLWMNCIRQARVRLQCKFYSSLLALPPALETAR | ||||||
Transmembrane | 82-102 | Helical | ||||
Sequence: ALMCVAVALSLIALLIGICGM | ||||||
Topological domain | 103-124 | Cytoplasmic | ||||
Sequence: KQVQCTGSNERAKAYLLGTSGV | ||||||
Transmembrane | 125-145 | Helical | ||||
Sequence: LFILTGIFVLIPVSWTANIII | ||||||
Topological domain | 146-164 | Extracellular | ||||
Sequence: RDFYNPAIHIGQKRELGAA | ||||||
Transmembrane | 165-185 | Helical | ||||
Sequence: LFLGWASAAVLFIGGGLLCGF | ||||||
Topological domain | 186-224 | Cytoplasmic | ||||
Sequence: CCCNRKKQGYRYPVPGYRVPHTDKRRNTTMLSKTSTSYV |
Keywords
- Cellular component
Disease & Variants
Features
Showing features for mutagenesis, natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 31 | Decreased transepithelial resistance and anion selectivity. Higher permeability to chloride, sodium and also to larger anions, including pyruvate, nitrate, and thiocyanate. | ||||
Sequence: R → E | ||||||
Mutagenesis | 44 | Decreased transepithelial resistance and anion selectivity. | ||||
Sequence: E → A | ||||||
Mutagenesis | 45 | Decreased transepithelial resistance, no effect on anion selectivity. | ||||
Sequence: R → A | ||||||
Mutagenesis | 48 | Decreased transepithelial resistance and anion selectivity. Higher permeability to chloride, sodium and also to larger anions, including pyruvate, nitrate, and thiocyanate. | ||||
Sequence: E → K or Q | ||||||
Mutagenesis | 56 | No effect on transepithelial resistance, nor on anion selectivity. Elevated permeabilities not only for chloride, but also for sodium and the larger anions, including pyruvate, nitrate and thiocyanate. | ||||
Sequence: R → A | ||||||
Mutagenesis | 56 | Decreased anion selectivity. Increased permeabilities not only for chloride, but also for sodium and thiocyanate. No effect on transepithelial resistance. | ||||
Sequence: R → T | ||||||
Mutagenesis | 59 | No effect on transepithelial resistance, nor on anion selectivity. Increased permeability for thiocyanate. | ||||
Sequence: R → A | ||||||
Mutagenesis | 61 | Decreased anion selectivity. No effect on transepithelial resistance. | ||||
Sequence: R → A | ||||||
Mutagenesis | 65 | Reduced channel formation ability. Increased transepithelial resistance. Loss of anion selectivity in favor of cation selectivity. | ||||
Sequence: K → A | ||||||
Mutagenesis | 65 | No effect on channel formation ability. Loss of anion selectivity in favor of cation selectivity. No effect on transepithelial resistance. | ||||
Sequence: K → E | ||||||
Mutagenesis | 65 | Strongly reduced channel formation ability. Increased transepithelial resistance. Loss of anion selectivity in favor of cation selectivity. | ||||
Sequence: K → R | ||||||
Mutagenesis | 68 | Increased transepithelial resistance. Loss of anion selectivity in favor of cation (sodium) selectivity. | ||||
Sequence: S → E | ||||||
Natural variant | VAR_033774 | 82 | in dbSNP:rs35531957 | |||
Sequence: A → T | ||||||
Mutagenesis | 149 | Increased transepithelial resistance. No effect on localization to cell-cell junctions. | ||||
Sequence: Y → A | ||||||
Mutagenesis | 154 | Loss of anion selectivity. Strongly increased permeabilities not only for chloride, but also for sodium and the larger anions, including pyruvate, nitrate and thiocyanate. No effect on localization to cell-cell junctions. | ||||
Sequence: H → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 297 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000144777 | 1-224 | Claudin-17 | |||
Sequence: MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARVRLQCKFYSSLLALPPALETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPAIHIGQKRELGAALFLGWASAAVLFIGGGLLCGFCCCNRKKQGYRYPVPGYRVPHTDKRRNTTMLSKTSTSYV |
Proteomic databases
PTM databases
Structure
Sequence
- Sequence statusComplete
- Length224
- Mass (Da)24,603
- Last updated2000-05-30 v1
- Checksum1833ED3178B7F63A
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ250712 EMBL· GenBank· DDBJ | CAB60616.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY358094 EMBL· GenBank· DDBJ | AAQ88461.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
AP001707 EMBL· GenBank· DDBJ | BAA95566.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC101503 EMBL· GenBank· DDBJ | AAI01504.1 EMBL· GenBank· DDBJ | mRNA | ||
BC101505 EMBL· GenBank· DDBJ | AAI01506.1 EMBL· GenBank· DDBJ | mRNA |