P56501 · UCP3_MOUSE
- ProteinPutative mitochondrial transporter UCP3
- GeneUcp3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids308 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Putative transmembrane transporter that plays a role in mitochondrial metabolism via an as yet unclear mechanism (PubMed:10748195, PubMed:10748196).
Originally, this mitochondrial protein was thought to act as a proton transmembrane transporter from the mitochondrial intermembrane space into the matrix, causing proton leaks through the inner mitochondrial membrane, thereby uncoupling mitochondrial membrane potential generation from ATP synthesis (PubMed:29212043).
However, this function is controversial and uncoupling may not be the function, or at least not the main function, but rather a consequence of more conventional metabolite transporter activity (PubMed:11707458, PubMed:20363757).
Originally, this mitochondrial protein was thought to act as a proton transmembrane transporter from the mitochondrial intermembrane space into the matrix, causing proton leaks through the inner mitochondrial membrane, thereby uncoupling mitochondrial membrane potential generation from ATP synthesis (PubMed:29212043).
However, this function is controversial and uncoupling may not be the function, or at least not the main function, but rather a consequence of more conventional metabolite transporter activity (PubMed:11707458, PubMed:20363757).
Activity regulation
Inhibited by purine nucleotides and inorganic phosphate (in vitro).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | mitochondrion | |
Molecular Function | oxidative phosphorylation uncoupler activity | |
Molecular Function | proton transmembrane transporter activity | |
Biological Process | adaptive thermogenesis | |
Biological Process | cellular response to hormone stimulus | |
Biological Process | fatty acid metabolic process | |
Biological Process | lipid hydroperoxide transport | |
Biological Process | mitochondrial transmembrane transport | |
Biological Process | proton transmembrane transport | |
Biological Process | response to activity | |
Biological Process | response to cold | |
Biological Process | response to fenofibrate | |
Biological Process | response to glucocorticoid | |
Biological Process | response to hypoxia | |
Biological Process | response to insulin | |
Biological Process | response to nutrient | |
Biological Process | response to superoxide |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePutative mitochondrial transporter UCP3
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP56501
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-10 | Mitochondrial intermembrane | ||||
Sequence: MVGLQPSEVP | ||||||
Transmembrane | 11-32 | Helical; Name=1 | ||||
Sequence: PTTVVKFLGAGTAACFADLLTF | ||||||
Topological domain | 33-73 | Mitochondrial matrix | ||||
Sequence: PLDTAKVRLQIQGENPGAQSVQYRGVLGTILTMVRTEGPRS | ||||||
Transmembrane | 74-96 | Helical; Name=2 | ||||
Sequence: PYSGLVAGLHRQMSFASIRIGLY | ||||||
Topological domain | 97-116 | Mitochondrial intermembrane | ||||
Sequence: DSVKQFYTPKGADHSSVAIR | ||||||
Transmembrane | 117-133 | Helical; Name=3 | ||||
Sequence: ILAGCTTGAMAVTCAQP | ||||||
Topological domain | 134-179 | Mitochondrial matrix | ||||
Sequence: TDVVKVRFQAMIRLGTGGERKYRGTMDAYRTIAREEGVRGLWKGTW | ||||||
Transmembrane | 180-196 | Helical; Name=4 | ||||
Sequence: PNITRNAIVNCAEMVTY | ||||||
Topological domain | 197-213 | Mitochondrial intermembrane | ||||
Sequence: DIIKEKLLESHLFTDNF | ||||||
Transmembrane | 214-233 | Helical; Name=5 | ||||
Sequence: PCHFVSAFGAGFCATVVASP | ||||||
Topological domain | 234-267 | Mitochondrial matrix | ||||
Sequence: VDVVKTRYMNAPLGRYRSPLHCMLKMVAQEGPTA | ||||||
Transmembrane | 268-290 | Helical; Name=6 | ||||
Sequence: FYKGFVPSFLRLGAWNVMMFVTY | ||||||
Topological domain | 291-308 | Mitochondrial intermembrane | ||||
Sequence: EQLKRALMKVQVLRESPF |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Homozygous knockout mice lacking Ucp3 show no overt phenotype being born at the expected frequency, with no observed signs of abnormality, illness, or increased mortality at up to one year of age. They are not obese and have reduced free fatty acids and glucose serum levels. They show a normal circadian rhythm in body temperature and motor activity and have normal body temperature responses to fasting, stress, thyroid hormone, and cold exposure. The baseline metabolic rate and respiratory exchange ratio are the same in knockout and control mice. However, there is decreased proton leak in the mitochondria over the complete range of metabolic rates studied (PubMed:10748195, PubMed:10748196).
Mitochondria are more coupled and the production of reactive oxygen species is increased. No effect on exercise tolerance and fatty acid oxidation is observed (PubMed:10748196).
Mitochondria are more coupled and the production of reactive oxygen species is increased. No effect on exercise tolerance and fatty acid oxidation is observed (PubMed:10748196).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 84 | Changed proton transmembrane transport. Decreased inhibition by ATP and ADP. No effect on AMP-mediated inhibition. | ||||
Sequence: R → Q | ||||||
Mutagenesis | 184 | Changed proton transmembrane transport. Loss of inhibition by the purine nucleotides ATP, ADP and AMP. | ||||
Sequence: R → T | ||||||
Mutagenesis | 278 | No effect on proton transmembrane transport. No effect on inhibition by ATP, ADP and AMP. | ||||
Sequence: R → L |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 10 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000090673 | 1-308 | Putative mitochondrial transporter UCP3 | |||
Sequence: MVGLQPSEVPPTTVVKFLGAGTAACFADLLTFPLDTAKVRLQIQGENPGAQSVQYRGVLGTILTMVRTEGPRSPYSGLVAGLHRQMSFASIRIGLYDSVKQFYTPKGADHSSVAIRILAGCTTGAMAVTCAQPTDVVKVRFQAMIRLGTGGERKYRGTMDAYRTIAREEGVRGLWKGTWPNITRNAIVNCAEMVTYDIIKEKLLESHLFTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNAPLGRYRSPLHCMLKMVAQEGPTAFYKGFVPSFLRLGAWNVMMFVTYEQLKRALMKVQVLRESPF |
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for repeat, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 11-102 | Solcar 1 | ||||
Sequence: PTTVVKFLGAGTAACFADLLTFPLDTAKVRLQIQGENPGAQSVQYRGVLGTILTMVRTEGPRSPYSGLVAGLHRQMSFASIRIGLYDSVKQF | ||||||
Repeat | 111-202 | Solcar 2 | ||||
Sequence: SSVAIRILAGCTTGAMAVTCAQPTDVVKVRFQAMIRLGTGGERKYRGTMDAYRTIAREEGVRGLWKGTWPNITRNAIVNCAEMVTYDIIKEK | ||||||
Repeat | 211-296 | Solcar 3 | ||||
Sequence: DNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNAPLGRYRSPLHCMLKMVAQEGPTAFYKGFVPSFLRLGAWNVMMFVTYEQLKRA | ||||||
Region | 275-297 | Purine nucleotide binding | ||||
Sequence: SFLRLGAWNVMMFVTYEQLKRAL |
Sequence similarities
Belongs to the mitochondrial carrier (TC 2.A.29) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length308
- Mass (Da)33,911
- Last updated1998-07-15 v1
- Checksum12CAD7674DF7D0C3
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 179 | in Ref. 6; BAA31989 | ||||
Sequence: W → L |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF032902 EMBL· GenBank· DDBJ | AAB87084.1 EMBL· GenBank· DDBJ | mRNA | ||
AB010742 EMBL· GenBank· DDBJ | BAA25697.1 EMBL· GenBank· DDBJ | mRNA | ||
AF030164 EMBL· GenBank· DDBJ | AAD01892.1 EMBL· GenBank· DDBJ | mRNA | ||
AB008216 EMBL· GenBank· DDBJ | BAA33502.1 EMBL· GenBank· DDBJ | mRNA | ||
AF053352 EMBL· GenBank· DDBJ | AAC28328.1 EMBL· GenBank· DDBJ | mRNA | ||
AB013132 EMBL· GenBank· DDBJ | BAA31989.1 EMBL· GenBank· DDBJ | mRNA | ||
AF019883 EMBL· GenBank· DDBJ | AAB71543.1 EMBL· GenBank· DDBJ | mRNA |