P55916 · UCP3_HUMAN
- ProteinPutative mitochondrial transporter UCP3
- GeneUCP3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids312 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Putative transmembrane transporter that plays a role in mitochondrial metabolism via an as yet unclear mechanism (PubMed:21775425, PubMed:36114012).
Originally, this mitochondrial protein was thought to act as a proton transmembrane transporter from the mitochondrial intermembrane space into the matrix, causing proton leaks through the inner mitochondrial membrane, thereby uncoupling mitochondrial membrane potential generation from ATP synthesis (PubMed:11171965, PubMed:12670931, PubMed:12734183, PubMed:9305858).
However, this function is controversial and uncoupling may not be the function, or at least not the main function, but rather a consequence of more conventional metabolite transporter activity (PubMed:11707458).
Originally, this mitochondrial protein was thought to act as a proton transmembrane transporter from the mitochondrial intermembrane space into the matrix, causing proton leaks through the inner mitochondrial membrane, thereby uncoupling mitochondrial membrane potential generation from ATP synthesis (PubMed:11171965, PubMed:12670931, PubMed:12734183, PubMed:9305858).
However, this function is controversial and uncoupling may not be the function, or at least not the main function, but rather a consequence of more conventional metabolite transporter activity (PubMed:11707458).
Activity regulation
The proton transporter activity is activated by fatty acids (in vitro) (PubMed:11171965).
The proton transporter activity is inhibited by ATP and ADP (in vitro) (PubMed:11171965).
The effect of Ubiquinone/coenzyme Q10 on the proton transporter activity in reconstituted membranes is unclear (in vitro) (PubMed:11171965, PubMed:12734183).
The proton transporter activity is inhibited by ATP and ADP (in vitro) (PubMed:11171965).
The effect of Ubiquinone/coenzyme Q10 on the proton transporter activity in reconstituted membranes is unclear (in vitro) (PubMed:11171965, PubMed:12734183).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | mitochondrion | |
Molecular Function | oxidative phosphorylation uncoupler activity | |
Molecular Function | proton transmembrane transporter activity | |
Biological Process | adaptive thermogenesis | |
Biological Process | cellular response to hormone stimulus | |
Biological Process | fatty acid metabolic process | |
Biological Process | lipid hydroperoxide transport | |
Biological Process | lipid metabolic process | |
Biological Process | mitochondrial transmembrane transport | |
Biological Process | proton transmembrane transport | |
Biological Process | respiratory gaseous exchange by respiratory system | |
Biological Process | response to activity | |
Biological Process | response to cold | |
Biological Process | response to fenofibrate | |
Biological Process | response to glucocorticoid | |
Biological Process | response to hypoxia | |
Biological Process | response to insulin | |
Biological Process | response to nutrient | |
Biological Process | response to superoxide |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended namePutative mitochondrial transporter UCP3
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP55916
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-10 | Mitochondrial intermembrane | ||||
Sequence: MVGLKPSDVP | ||||||
Transmembrane | 11-32 | Helical; Name=1 | ||||
Sequence: PTMAVKFLGAGTAACFADLVTF | ||||||
Topological domain | 33-76 | Mitochondrial matrix | ||||
Sequence: PLDTAKVRLQIQGENQAVQTARLVQYRGVLGTILTMVRTEGPCS | ||||||
Transmembrane | 77-99 | Helical; Name=2 | ||||
Sequence: PYNGLVAGLQRQMSFASIRIGLY | ||||||
Topological domain | 100-119 | Mitochondrial intermembrane | ||||
Sequence: DSVKQVYTPKGADNSSLTTR | ||||||
Transmembrane | 120-136 | Helical; Name=3 | ||||
Sequence: ILAGCTTGAMAVTCAQP | ||||||
Topological domain | 137-183 | Mitochondrial matrix | ||||
Sequence: TDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTL | ||||||
Transmembrane | 184-200 | Helical; Name=4 | ||||
Sequence: PNIMRNAIVNCAEVVTY | ||||||
Topological domain | 201-217 | Mitochondrial intermembrane | ||||
Sequence: DILKEKLLDYHLLTDNF | ||||||
Transmembrane | 218-237 | Helical; Name=5 | ||||
Sequence: PCHFVSAFGAGFCATVVASP | ||||||
Topological domain | 238-271 | Mitochondrial matrix | ||||
Sequence: VDVVKTRYMNSPPGQYFSPLDCMIKMVAQEGPTA | ||||||
Transmembrane | 272-294 | Helical; Name=6 | ||||
Sequence: FYKGFTPSFLRLGSWNVVMFVTY | ||||||
Topological domain | 295-312 | Mitochondrial intermembrane | ||||
Sequence: EQLKRALMKVQMLRESPF |
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Obesity (OBESITY)
- Note
- DescriptionA condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat.
- See alsoMIM:601665
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_050136 | 9 | in dbSNP:rs8179180 | |||
Sequence: V → M | ||||||
Natural variant | VAR_004407 | 70 | in severe obesity with type 2 diabetes; dbSNP:rs17848368 | |||
Sequence: R → W | ||||||
Natural variant | VAR_004408 | 102 | in obesity; dbSNP:rs2229707 | |||
Sequence: V → I |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 410 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000090672 | 1-312 | Putative mitochondrial transporter UCP3 | |||
Sequence: MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRGVLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTRILAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRALMKVQMLRESPF |
Proteomic databases
PTM databases
Expression
Tissue specificity
Only in skeletal muscle and heart (PubMed:9305858).
Also expressed in white and brown adipose tissues (PubMed:9305858).
Is more expressed in glycolytic than in oxidative skeletal muscles
Also expressed in white and brown adipose tissues (PubMed:9305858).
Is more expressed in glycolytic than in oxidative skeletal muscles
Induction
Up-regulated by beta3-adrenergic stimulation, starvation, glucocorticoids and leptin.
Gene expression databases
Organism-specific databases
Structure
Family & Domains
Features
Showing features for repeat, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 11-105 | Solcar 1 | ||||
Sequence: PTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRGVLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQV | ||||||
Repeat | 114-206 | Solcar 2 | ||||
Sequence: SSLTTRILAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILKEK | ||||||
Repeat | 215-300 | Solcar 3 | ||||
Sequence: DNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRA | ||||||
Region | 279-301 | Purine nucleotide binding | ||||
Sequence: SFLRLGSWNVVMFVTYEQLKRAL |
Sequence similarities
Belongs to the mitochondrial carrier (TC 2.A.29) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
P55916-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameUCP3L
- Length312
- Mass (Da)34,216
- Last updated1997-11-01 v1
- ChecksumD0E04A8DB352B17C
P55916-2
- NameUCP3S
- Differences from canonical
- 276-312: Missing
P55916-3
- Name3
- Differences from canonical
- 114-216: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F5H3N5 | F5H3N5_HUMAN | UCP3 | 96 |
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U84763 EMBL· GenBank· DDBJ | AAC51367.1 EMBL· GenBank· DDBJ | mRNA | ||
U82818 EMBL· GenBank· DDBJ | AAC51356.1 EMBL· GenBank· DDBJ | mRNA | ||
AF001787 EMBL· GenBank· DDBJ | AAC51369.1 EMBL· GenBank· DDBJ | mRNA | ||
AF011449 EMBL· GenBank· DDBJ | AAC51767.1 EMBL· GenBank· DDBJ | mRNA | ||
AF012202 EMBL· GenBank· DDBJ | AAC51785.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
AF012197 EMBL· GenBank· DDBJ | AAC51785.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
AF012198 EMBL· GenBank· DDBJ | AAC51785.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
AF012199 EMBL· GenBank· DDBJ | AAC51785.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
AF012200 EMBL· GenBank· DDBJ | AAC51785.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
AF012201 EMBL· GenBank· DDBJ | AAC51785.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
AF026958 EMBL· GenBank· DDBJ | AAC18822.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF026956 EMBL· GenBank· DDBJ | AAC18822.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF026957 EMBL· GenBank· DDBJ | AAC18822.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF050113 EMBL· GenBank· DDBJ | AAG02284.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC008392 EMBL· GenBank· DDBJ | AAH08392.1 EMBL· GenBank· DDBJ | mRNA |