P54851 · EMP2_HUMAN
- ProteinEpithelial membrane protein 2
- GeneEMP2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids167 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Functions as a key regulator of cell membrane composition by regulating protein surface expression. Also, plays a role in regulation of processes including cell migration, cell proliferation, cell contraction and cell adhesion. Regulates transepithelial migration of neutrophils into the alveolar lumen, potentially via mediation of cell surface expression of adhesion markers and lipid raft formation (By similarity).
Negatively regulates caveolae formation by reducing CAV1 expression and CAV1 amount by increasing lysosomal degradation (PubMed:24814193).
Facilitates surface trafficking and formation of lipid rafts bearing GPI-anchor proteins (By similarity).
Regulates surface expression of MHC1 and ICAM1 proteins increasing susceptibility to T-cell mediated cytotoxicity (By similarity).
Regulates the plasma membrane expression of the integrin heterodimers ITGA6-ITGB1, ITGA5-ITGB3 and ITGA5-ITGB1 resulting in modulation of cell-matrix adhesion (PubMed:16216233).
Also regulates many processes through PTK2. Regulates blood vessel endothelial cell migration and angiogenesis by regulating VEGF protein expression through PTK2 activation (PubMed:23439602).
Regulates cell migration and cell contraction through PTK2 and SRC activation (PubMed:21637765, PubMed:22728127).
Regulates focal adhesion density, F-actin conformation and cell adhesion capacity through interaction with PTK2 (PubMed:19494199).
Positively regulates cell proliferation (PubMed:24814193).
Plays a role during cell death and cell blebbing (PubMed:12107182).
Promotes angiogenesis and vasculogenesis through induction of VEGFA via a HIF1A-dependent pathway (PubMed:23334331).
Also plays a role in embryo implantation by regulating surface trafficking of integrin heterodimer ITGA5-ITGB3 (PubMed:16487956).
Plays a role in placental angiogenesis and uterine natural killer cell regulation at the maternal-fetal placental interface, however not required in the maternal tissues for a viable pregnancy (By similarity).
Involved in the early stages of embryogenic development and cardiogenesis, potentially via regulation of epithelial-mesenchymal transition timing (By similarity).
May play a role in glomerular filtration (By similarity).
Negatively regulates caveolae formation by reducing CAV1 expression and CAV1 amount by increasing lysosomal degradation (PubMed:24814193).
Facilitates surface trafficking and formation of lipid rafts bearing GPI-anchor proteins (By similarity).
Regulates surface expression of MHC1 and ICAM1 proteins increasing susceptibility to T-cell mediated cytotoxicity (By similarity).
Regulates the plasma membrane expression of the integrin heterodimers ITGA6-ITGB1, ITGA5-ITGB3 and ITGA5-ITGB1 resulting in modulation of cell-matrix adhesion (PubMed:16216233).
Also regulates many processes through PTK2. Regulates blood vessel endothelial cell migration and angiogenesis by regulating VEGF protein expression through PTK2 activation (PubMed:23439602).
Regulates cell migration and cell contraction through PTK2 and SRC activation (PubMed:21637765, PubMed:22728127).
Regulates focal adhesion density, F-actin conformation and cell adhesion capacity through interaction with PTK2 (PubMed:19494199).
Positively regulates cell proliferation (PubMed:24814193).
Plays a role during cell death and cell blebbing (PubMed:12107182).
Promotes angiogenesis and vasculogenesis through induction of VEGFA via a HIF1A-dependent pathway (PubMed:23334331).
Also plays a role in embryo implantation by regulating surface trafficking of integrin heterodimer ITGA5-ITGB3 (PubMed:16487956).
Plays a role in placental angiogenesis and uterine natural killer cell regulation at the maternal-fetal placental interface, however not required in the maternal tissues for a viable pregnancy (By similarity).
Involved in the early stages of embryogenic development and cardiogenesis, potentially via regulation of epithelial-mesenchymal transition timing (By similarity).
May play a role in glomerular filtration (By similarity).
GO annotations
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameEpithelial membrane protein 2
- Short namesEMP-2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP54851
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Golgi apparatus membrane ; Multi-pass membrane protein
Note: Localizes in cytoplasm, foot processes and cell bodies of podocytes and nucleus of endothelial cells of kidney. Localizes to the apical cell surface in the luminal epithelium and glandular epithelium. Colocalized with ITGB1 and GPI-anchor proteins on plasma membrane.
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 1-21 | Helical | ||||
Sequence: MLVLLAFIIAFHITSAALLFI | ||||||
Transmembrane | 67-87 | Helical | ||||
Sequence: TMILSTILCCIAFFIFVLQLF | ||||||
Transmembrane | 95-115 | Helical | ||||
Sequence: FVLTSIIQLMSCLCVMIAASI | ||||||
Transmembrane | 143-163 | Helical | ||||
Sequence: YILAWVAFACTFISGMMYLIL |
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Nephrotic syndrome 10 (NPHS10)
- Note
- DescriptionA form of nephrotic syndrome, a renal disease clinically characterized by focal segmental glomerulosclerosis, progressive renal failure, severe proteinuria, hypoalbuminemia, hyperlipidemia and edema. NPHS10 is a steroid-sensitive form characterized by onset in childhood and remission without end-stage kidney disease.
- See alsoMIM:615861
Natural variants in NPHS10
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_071478 | 7 | F>L | in NPHS10; decreased amount of CAV1; dbSNP:rs730882194 | |
VAR_071479 | 10 | A>T | in NPHS10; decreased amount of CAV1; dbSNP:rs587777482 |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_071478 | 7 | in NPHS10; decreased amount of CAV1; dbSNP:rs730882194 | |||
Sequence: F → L | ||||||
Natural variant | VAR_071479 | 10 | in NPHS10; decreased amount of CAV1; dbSNP:rs587777482 | |||
Sequence: A → T |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 250 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000164658 | 1-167 | Epithelial membrane protein 2 | |||
Sequence: MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYSTLQAVQATMILSTILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAFACTFISGMMYLILRKRK | ||||||
Glycosylation | 44 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 47 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 52 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in ciliary body epithelia, sclera, cornea, and retinal pigment epithelium (at protein level) (PubMed:12710941).
Expressed in lung and endometrial tissue; expression is particularly abundant in secretory endometrium (at protein level) (PubMed:12710941).
Expressed in placental villous syncytiotrophoblasts and cytotrophoblasts and on the membrane of interstitial trophoblasts (at protein level) (PubMed:28295343).
Expressed in lung and endometrial tissue; expression is particularly abundant in secretory endometrium (at protein level) (PubMed:12710941).
Expressed in placental villous syncytiotrophoblasts and cytotrophoblasts and on the membrane of interstitial trophoblasts (at protein level) (PubMed:28295343).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with PTK2; regulates PTK2 activation and localization (PubMed:19494199, PubMed:21637765).
Interacts with ITGB3; regulates the levels of the heterodimer ITGA5-ITGB3 integrin surface expression (PubMed:16216233).
Interacts with P2RX7 (via C-terminus) (PubMed:12107182).
Interacts with ITGB1; the interaction may be direct or indirect and ITGB1 has a heterodimer form
Interacts with ITGB3; regulates the levels of the heterodimer ITGA5-ITGB3 integrin surface expression (PubMed:16216233).
Interacts with P2RX7 (via C-terminus) (PubMed:12107182).
Interacts with ITGB1; the interaction may be direct or indirect and ITGB1 has a heterodimer form
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length167
- Mass (Da)19,199
- Last updated1996-10-01 v1
- Checksum3E341DF3581EBCBF
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 20 | in Ref. 3; CAA64393 | ||||
Sequence: F → L | ||||||
Sequence conflict | 64 | in Ref. 3; CAA64393 | ||||
Sequence: V → F |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U52100 EMBL· GenBank· DDBJ | AAC51779.1 EMBL· GenBank· DDBJ | mRNA | ||
X94770 EMBL· GenBank· DDBJ | CAA64393.1 EMBL· GenBank· DDBJ | mRNA | ||
AY057060 EMBL· GenBank· DDBJ | AAL27085.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK313134 EMBL· GenBank· DDBJ | BAG35953.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471112 EMBL· GenBank· DDBJ | EAW85180.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471112 EMBL· GenBank· DDBJ | EAW85181.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471112 EMBL· GenBank· DDBJ | EAW85182.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC009687 EMBL· GenBank· DDBJ | AAH09687.1 EMBL· GenBank· DDBJ | mRNA |