P54286 · CACB3_RABIT
- ProteinVoltage-dependent L-type calcium channel subunit beta-3
- GeneCACNB3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids477 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Regulatory subunit of the voltage-gated calcium channel that gives rise to L-type calcium currents (PubMed:1312465).
Increases CACNA1B peak calcium current and shifts the voltage dependencies of channel activation and inactivation (By similarity).
Increases CACNA1C peak calcium current and shifts the voltage dependencies of channel activation and inactivation (By similarity).
Increases CACNA1B peak calcium current and shifts the voltage dependencies of channel activation and inactivation (By similarity).
Increases CACNA1C peak calcium current and shifts the voltage dependencies of channel activation and inactivation (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | L-type voltage-gated calcium channel complex | |
Molecular Function | calcium channel regulator activity | |
Molecular Function | voltage-gated calcium channel activity | |
Biological Process | calcium ion transmembrane transport via high voltage-gated calcium channel | |
Biological Process | positive regulation of high voltage-gated calcium channel activity |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameVoltage-dependent L-type calcium channel subunit beta-3
- Short namesCAB3
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Lagomorpha > Leporidae > Oryctolagus
Accessions
- Primary accessionP54286
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000144058 | 1-477 | Voltage-dependent L-type calcium channel subunit beta-3 | |||
Sequence: MYEDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPVAFAVRTNVSYCGVLDEECPVQGSGINFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPSPQRLESIRLKQEQKARRSGNPSSLSDIGNRRSPPPSLAKQKQKQAEHVPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLNNPGKRTIIERSSARSSIAEVQSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFVKVSSPKVLQRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLAEYLEVYWRATHHPAPGPGLLGPPSAIPGLQSQQLLGERGEEHSPLERDSLMPSDEAWTGSSQRSSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHNDRNWQRNRPWPKDSY | ||||||
Modified residue | 152 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 393 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
Expression
Tissue specificity
Most abundant in brain but also present in aorta, trachea and lung.
Interaction
Subunit
Component of a calcium channel complex consisting of a pore-forming alpha subunit (CACNA1C) and the ancillary subunits CACNB3 and CACNA2D1 (PubMed:1312465).
The channel complex contains alpha, beta, gamma and delta subunits in a 1:1:1:1 ratio. Interacts with CACNA2D4. Interacts with FASLG (By similarity).
Interacts with CBARP; prevents the interaction of CACNB3 with the alpha subunit CACNA1C thereby negatively regulating the activity of the corresponding calcium channel (By similarity).
The channel complex contains alpha, beta, gamma and delta subunits in a 1:1:1:1 ratio. Interacts with CACNA2D4. Interacts with FASLG (By similarity).
Interacts with CBARP; prevents the interaction of CACNB3 with the alpha subunit CACNA1C thereby negatively regulating the activity of the corresponding calcium channel (By similarity).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-52 | Disordered | ||||
Sequence: MYEDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQL | ||||||
Compositional bias | 29-52 | Basic and acidic residues | ||||
Sequence: SDVSLEEDRESARREVESQAQQQL | ||||||
Domain | 59-128 | SH3 | ||||
Sequence: PVAFAVRTNVSYCGVLDEECPVQGSGINFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPSPQRLESIR | ||||||
Region | 129-170 | Disordered | ||||
Sequence: LKQEQKARRSGNPSSLSDIGNRRSPPPSLAKQKQKQAEHVPP | ||||||
Compositional bias | 136-159 | Polar residues | ||||
Sequence: RRSGNPSSLSDIGNRRSPPPSLAK | ||||||
Region | 195-345 | Mediates interaction with the alpha subunit | ||||
Sequence: MMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLNNPGKRTIIERSSARSSIAEVQSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFVKVSSPKVLQRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDA | ||||||
Region | 385-477 | Disordered | ||||
Sequence: LGERGEEHSPLERDSLMPSDEAWTGSSQRSSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHNDRNWQRNRPWPKDSY | ||||||
Compositional bias | 451-477 | Basic and acidic residues | ||||
Sequence: RLLAQDSEHNHNDRNWQRNRPWPKDSY |
Sequence similarities
Belongs to the calcium channel beta subunit family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length477
- Mass (Da)53,814
- Last updated1996-10-01 v1
- ChecksumB9660513326511EB
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 29-52 | Basic and acidic residues | ||||
Sequence: SDVSLEEDRESARREVESQAQQQL | ||||||
Compositional bias | 136-159 | Polar residues | ||||
Sequence: RRSGNPSSLSDIGNRRSPPPSLAK | ||||||
Compositional bias | 451-477 | Basic and acidic residues | ||||
Sequence: RLLAQDSEHNHNDRNWQRNRPWPKDSY |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X64300 EMBL· GenBank· DDBJ | CAA45578.1 EMBL· GenBank· DDBJ | mRNA |