P54274 · TERF1_HUMAN
- ProteinTelomeric repeat-binding factor 1
- GeneTERF1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids439 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 403-428 | H-T-H motif | ||||
Sequence: WSKILLHYKFNNRTSVMLKDRWRTMK |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
The subsequence SRIPVSKSQPVTPEKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKLKLISSDSED, which contains the Myb_DNA-binding domain, shows transcriptional repressor activity in a high-throughput recruitment assay.
Names & Taxonomy
Protein names
- Recommended nameTelomeric repeat-binding factor 1
- Alternative names
Gene names
- Community suggested namesTERF1
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP54274
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Keywords
- Cellular component
Disease & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 74 | Abolishes dimerization and telomere binding; when associated with P-75. | ||||
Sequence: A → D | ||||||
Mutagenesis | 75 | Abolishes dimerization and telomere binding; when associated with D-74. | ||||
Sequence: A → P | ||||||
Mutagenesis | 77 | Abolishes telomere binding. | ||||
Sequence: W → P | ||||||
Mutagenesis | 81 | Abolishes telomere binding. | ||||
Sequence: F → P | ||||||
Mutagenesis | 90 | Diminishes telomere binding. | ||||
Sequence: F → P | ||||||
Mutagenesis | 115 | Loss of interaction with FBXO4. | ||||
Sequence: L → R | ||||||
Mutagenesis | 120 | Loss of interaction with FBXO4. | ||||
Sequence: L → R | ||||||
Mutagenesis | 219 | Loss of phosphorylation; induction of mitotic entry and apoptosis and increased radiation hypersensitivity of ataxia-telangiectasia cells. | ||||
Sequence: S → A | ||||||
Mutagenesis | 219 | Fails to induce apoptosis and decreases radiation hypersensitivity of ataxia-telangiectasia cells (phospho-mimicking mutants). | ||||
Sequence: S → D or E |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 466 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain, modified residue (large scale data), cross-link.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Initiator methionine | 1 | UniProt | Removed | ||||
Sequence: M | |||||||
Modified residue | 2 | UniProt | N-acetylalanine | ||||
Sequence: A | |||||||
Chain | PRO_0000197129 | 2-439 | UniProt | Telomeric repeat-binding factor 1 | |||
Sequence: AEDVSSAAPSPRGCADGRDADPTEEQMAETERNDEEQFECQELLECQVQVGAPEEEEEEEEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQLRTIYICQFLTRIAAGKTLDAQFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDPNSHMPFKSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVESKRTRTITSQDKPSGNDVEMETEANLDTRKSVSDKQSAVTESSEGTVSLLRSHKNLFLSKLQHGTQQQDLNKKERRVGTPQSTKKKKESRRATESRIPVSKSQPVTPEKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKLKLISSDSED | |||||||
Modified residue (large scale data) | 6 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 7 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 11 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 11 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 213 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 219 | UniProt | Phosphoserine; by ATM | ||||
Sequence: S | |||||||
Cross-link | 325 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 366 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 435 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 437 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Induction
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with TRIOBP isoform 1; mediates TERF1 localization to the centrosome (PubMed:24692559).
Binary interactions
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias, motif, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-36 | Disordered | ||||
Sequence: MAEDVSSAAPSPRGCADGRDADPTEEQMAETERNDE | ||||||
Compositional bias | 18-36 | Basic and acidic residues | ||||
Sequence: GRDADPTEEQMAETERNDE | ||||||
Region | 58-268 | TRFH mediates dimerization | ||||
Sequence: EEEEEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQLRTIYICQFLTRIAAGKTLDAQFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDPNSHMPFKSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVESKR | ||||||
Region | 265-378 | Interaction with RLIM | ||||
Sequence: ESKRTRTITSQDKPSGNDVEMETEANLDTRKSVSDKQSAVTESSEGTVSLLRSHKNLFLSKLQHGTQQQDLNKKERRVGTPQSTKKKKESRRATESRIPVSKSQPVTPEKHRAR | ||||||
Region | 266-311 | Disordered | ||||
Sequence: SKRTRTITSQDKPSGNDVEMETEANLDTRKSVSDKQSAVTESSEGT | ||||||
Compositional bias | 281-295 | Basic and acidic residues | ||||
Sequence: NDVEMETEANLDTRK | ||||||
Compositional bias | 296-311 | Polar residues | ||||
Sequence: SVSDKQSAVTESSEGT | ||||||
Region | 326-375 | Disordered | ||||
Sequence: LQHGTQQQDLNKKERRVGTPQSTKKKKESRRATESRIPVSKSQPVTPEKH | ||||||
Compositional bias | 332-360 | Basic and acidic residues | ||||
Sequence: QQDLNKKERRVGTPQSTKKKKESRRATES | ||||||
Motif | 337-356 | Nuclear localization signal | ||||
Sequence: KKERRVGTPQSTKKKKESRR | ||||||
Domain | 375-432 | HTH myb-type | ||||
Sequence: HRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKLKL |
Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P54274-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsTRF1
- Length439
- Mass (Da)50,246
- Last updated2008-09-23 v3
- ChecksumAB548E7D3124A211
P54274-2
- Name2
- SynonymsPin2
- Differences from canonical
- 296-315: Missing
Computationally mapped potential isoform sequences
There are 7 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
E7EWM7 | E7EWM7_HUMAN | TERF1 | 369 | ||
A0A7I2YQE7 | A0A7I2YQE7_HUMAN | TERF1 | 449 | ||
E5RFJ5 | E5RFJ5_HUMAN | TERF1 | 263 | ||
A0A7I2V3N9 | A0A7I2V3N9_HUMAN | TERF1 | 107 | ||
A0A7I2V5E0 | A0A7I2V5E0_HUMAN | TERF1 | 312 | ||
A0A7I2V5I6 | A0A7I2V5I6_HUMAN | TERF1 | 389 | ||
A0A7I2V5T5 | A0A7I2V5T5_HUMAN | TERF1 | 391 |
Features
Showing features for sequence conflict, compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 14 | in Ref. 1; AAB54036, 3; AAB17975/AAB81137 and 4; AAB53363 | ||||
Sequence: G → R | ||||||
Compositional bias | 18-36 | Basic and acidic residues | ||||
Sequence: GRDADPTEEQMAETERNDE | ||||||
Compositional bias | 281-295 | Basic and acidic residues | ||||
Sequence: NDVEMETEANLDTRK | ||||||
Compositional bias | 296-311 | Polar residues | ||||
Sequence: SVSDKQSAVTESSEGT | ||||||
Alternative sequence | VSP_003303 | 296-315 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 332-360 | Basic and acidic residues | ||||
Sequence: QQDLNKKERRVGTPQSTKKKKESRRATES | ||||||
Sequence conflict | 338 | in Ref. 8; CAA63768 | ||||
Sequence: K → E |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U40705 EMBL· GenBank· DDBJ | AAB54036.1 EMBL· GenBank· DDBJ | mRNA | ||
AF003001 EMBL· GenBank· DDBJ | AAB81137.1 EMBL· GenBank· DDBJ | mRNA | ||
AH003684 EMBL· GenBank· DDBJ | AAB17975.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U74382 EMBL· GenBank· DDBJ | AAB53363.1 EMBL· GenBank· DDBJ | mRNA | ||
EU088287 EMBL· GenBank· DDBJ | ABV02580.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC022893 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC029378 EMBL· GenBank· DDBJ | AAH29378.1 EMBL· GenBank· DDBJ | mRNA | ||
X93511 EMBL· GenBank· DDBJ | CAA63768.1 EMBL· GenBank· DDBJ | mRNA |