P54227 · STMN1_MOUSE
- ProteinStathmin
- GeneStmn1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids149 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis (By similarity).
Involved in the control of the learned and innate fear
Involved in the control of the learned and innate fear
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | membrane | |
Cellular Component | microtubule | |
Cellular Component | neuron projection | |
Molecular Function | tubulin binding | |
Biological Process | axonogenesis | |
Biological Process | establishment of skin barrier | |
Biological Process | hepatocyte growth factor receptor signaling pathway | |
Biological Process | microtubule depolymerization | |
Biological Process | mitotic cytokinesis | |
Biological Process | mitotic spindle organization | |
Biological Process | negative regulation of microtubule polymerization | |
Biological Process | negative regulation of Rho protein signal transduction | |
Biological Process | negative regulation of stress fiber assembly | |
Biological Process | negative regulation of thrombin-activated receptor signaling pathway | |
Biological Process | neuron projection development | |
Biological Process | regulation of cell migration | |
Biological Process | regulation of microtubule polymerization or depolymerization | |
Biological Process | response to virus |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameStathmin
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP54227
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Mice show deficits in spike-timing-dependent long-term potentiation, exhibit decreased memory in amygdala-dependent fear conditioning and fail to recognize danger in innately aversive environments.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 6 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylalanine | ||||
Sequence: A | ||||||
Chain | PRO_0000182390 | 2-149 | Stathmin | |||
Sequence: ASSDIQVKELEKRASGQAFELILSPRSKESVPDFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHVEEVRKNKESKDPADETEAD | ||||||
Modified residue | 4 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 9 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 16 | Phosphoserine; by PKA | ||||
Sequence: S | ||||||
Modified residue | 25 | Phosphoserine; by CDK1, MAPK1 and MAPK3 | ||||
Sequence: S | ||||||
Modified residue | 29 | N6-methyllysine | ||||
Sequence: K | ||||||
Modified residue | 31 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 38 | Phosphoserine; by CDK1, MAPK1 and MAPK3 | ||||
Sequence: S | ||||||
Modified residue | 63 | Phosphoserine; by PKA | ||||
Sequence: S | ||||||
Modified residue | 100 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 119 | N6-acetyllysine | ||||
Sequence: K |
Post-translational modification
Many different phosphorylated forms are observed depending on specific combinations among the sites which can be phosphorylated. MAPK is responsible for the phosphorylation of stathmin in response to NGF (Probable). Phosphorylation at Ser-16 seems to be required for neuron polarization (By similarity).
Keywords
- PTM
Proteomic databases
2D gel databases
PTM databases
Expression
Tissue specificity
Highly expressed in the lateral nucleus of the amygdala.
Gene expression databases
Interaction
Subunit
Binds to two alpha/beta-tubulin heterodimers. Interacts with KIST.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P54227 | Cdkn1b P46414 | 2 | EBI-1006438, EBI-1005742 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 4-145 | SLD | ||||
Sequence: SDIQVKELEKRASGQAFELILSPRSKESVPDFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHVEEVRKNKESKDPADE | ||||||
Region | 27-46 | Disordered | ||||
Sequence: RSKESVPDFPLSPPKKKDLS | ||||||
Coiled coil | 41-140 | |||||
Sequence: KKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHVEEVRKNKESK | ||||||
Region | 104-149 | Disordered | ||||
Sequence: KMEANKENREAQMAAKLERLREKDKHVEEVRKNKESKDPADETEAD |
Sequence similarities
Belongs to the stathmin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length149
- Mass (Da)17,274
- Last updated2007-01-23 v2
- Checksum616526E0A6667BDA
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L20256 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
L20257 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
L20258 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
X94915 EMBL· GenBank· DDBJ | CAA64401.1 EMBL· GenBank· DDBJ | mRNA | ||
BC010581 EMBL· GenBank· DDBJ | AAH10581.1 EMBL· GenBank· DDBJ | mRNA | ||
BC031831 EMBL· GenBank· DDBJ | AAH31831.1 EMBL· GenBank· DDBJ | mRNA | ||
BC054396 EMBL· GenBank· DDBJ | AAH54396.1 EMBL· GenBank· DDBJ | mRNA |