P54192 · OB19D_DROME
- ProteinGeneral odorant-binding protein 19d
- GeneObp19d
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids150 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | odorant binding | |
Molecular Function | pheromone binding | |
Biological Process | sensory perception of chemical stimulus | |
Biological Process | sensory perception of smell |
Names & Taxonomy
Protein names
- Recommended nameGeneral odorant-binding protein 19d
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionP54192
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Secreted in the lumen of olfactory hairs.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-23 | |||||
Sequence: MSHLVHLTVLLLVGILCLGATSA | ||||||
Chain | PRO_0000012587 | 24-150 | General odorant-binding protein 19d | |||
Sequence: KPHEEINRDHAAELANECKAETGATDEDVEQLMSHDLPERHEAKCLRACVMKKLQIMDESGKLNKEHAIELVKVMSKHDAEKEDAPAEVVAKCEAIETPEDHCDAAFAYEECIYEQMKEHGLELEEH | ||||||
Disulfide bond | 41↔72 | |||||
Sequence: CKAETGATDEDVEQLMSHDLPERHEAKCLRAC | ||||||
Disulfide bond | 68↔126 | |||||
Sequence: CLRACVMKKLQIMDESGKLNKEHAIELVKVMSKHDAEKEDAPAEVVAKCEAIETPEDHC | ||||||
Disulfide bond | 116↔135 | |||||
Sequence: CEAIETPEDHCDAAFAYEEC |
Keywords
- PTM
Proteomic databases
Expression
Tissue specificity
Expressed in the antenna, mostly on the anterior surface of the third antennal segment. Also detected in the maxillary palps and in cells at the bases of the taste hairs on the proboscis and internal taste organs of the head.
Gene expression databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P54192 | Nca P42325 | 4 | EBI-26770067, EBI-149848 |
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length150
- Mass (Da)16,782
- Last updated2005-06-21 v2
- ChecksumAEEC364FFA416FA9
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 34-35 | in Ref. 1; AAC46475 | ||||
Sequence: AA → LL | ||||||
Sequence conflict | 41 | in Ref. 4; AAM29626 | ||||
Sequence: C → S | ||||||
Sequence conflict | 141 | in Ref. 1; AAC46475 | ||||
Sequence: K → R |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U05981 EMBL· GenBank· DDBJ | AAC46475.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014298 EMBL· GenBank· DDBJ | AAF50907.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014298 EMBL· GenBank· DDBJ | AAO41713.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY113621 EMBL· GenBank· DDBJ | AAM29626.1 EMBL· GenBank· DDBJ | mRNA | ||
AY118484 EMBL· GenBank· DDBJ | AAM49853.1 EMBL· GenBank· DDBJ | mRNA | ||
BT032672 EMBL· GenBank· DDBJ | ACD81686.1 EMBL· GenBank· DDBJ | mRNA | Different initiation |