P53941 · IMP4_YEAST
- ProteinU3 small nucleolar ribonucleoprotein protein IMP4
- GeneIMP4
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids290 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Required for the early cleavages at sites A0, A1 and A2 during 18S ribosomal pre-RNA processing.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | 90S preribosome | |
Cellular Component | Mpp10 complex | |
Cellular Component | nucleolus | |
Cellular Component | nucleoplasm | |
Cellular Component | small-subunit processome | |
Molecular Function | rRNA primary transcript binding | |
Molecular Function | single-stranded telomeric DNA binding | |
Molecular Function | snoRNA binding | |
Biological Process | maturation of SSU-rRNA | |
Biological Process | ribosomal small subunit biogenesis | |
Biological Process | rRNA processing |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameU3 small nucleolar ribonucleoprotein protein IMP4
- Short namesU3 snoRNP protein IMP4
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP53941
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 119 | No effect on RNA binding. | ||||
Sequence: R → A | ||||||
Mutagenesis | 201 | No effect on RNA binding. | ||||
Sequence: R → A | ||||||
Mutagenesis | 220 | Loss of RNA binding. | ||||
Sequence: R → A | ||||||
Mutagenesis | 253 | Loss of RNA binding. | ||||
Sequence: R → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1 variant from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000120245 | 1-290 | U3 small nucleolar ribonucleoprotein protein IMP4 | |||
Sequence: MLRRQARERREYLYRKAQELQDSQLQQKRQIIKQALAQGKPLPKELAEDESLQKDFRYDQSLKESEEADDLQVDDEYAATSGIMDPRIIVTTSRDPSTRLSQFAKEIKLLFPNAVRLNRGNYVMPNLVDACKKSGTTDLVVLHEHRGVPTSLTISHFPHGPTAQFSLHNVVMRHDIINAGNQSEVNPHLIFDNFTTALGKRVVCILKHLFNAGPKKDSERVITFANRGDFISVRQHVYVRTREGVEIAEVGPRFEMRLFELRLGTLENKDADVEWQLRRFIRTANKKDYL |
Proteomic databases
PTM databases
Interaction
Subunit
Component of a heterotrimeric complex containing IMP3, IMP4 and MPP10. Interacts with MPP10. Component of the ribosomal small subunit (SSU) processome composed of at least 40 protein subunits and snoRNA U3.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P53941 | DHR2 P36009 | 2 | EBI-9243, EBI-5844 | |
BINARY | P53941 | ENP1 P38333 | 7 | EBI-9243, EBI-6482 | |
BINARY | P53941 | MPP10 P47083 | 8 | EBI-9243, EBI-11168 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 86-267 | Brix | ||||
Sequence: PRIIVTTSRDPSTRLSQFAKEIKLLFPNAVRLNRGNYVMPNLVDACKKSGTTDLVVLHEHRGVPTSLTISHFPHGPTAQFSLHNVVMRHDIINAGNQSEVNPHLIFDNFTTALGKRVVCILKHLFNAGPKKDSERVITFANRGDFISVRQHVYVRTREGVEIAEVGPRFEMRLFELRLGTLE |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length290
- Mass (Da)33,482
- Last updated1996-10-01 v1
- ChecksumDF9F863364848B63
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X86470 EMBL· GenBank· DDBJ | CAA60184.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z71351 EMBL· GenBank· DDBJ | CAA95949.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006947 EMBL· GenBank· DDBJ | DAA10470.1 EMBL· GenBank· DDBJ | Genomic DNA |