P53845 · YIF1_YEAST
- ProteinProtein transport protein YIF1
- GeneYIF1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids314 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Required for fusion of ER-derived vesicles with the Golgi during ER-to-Golgi protein transport. May be involved in proper membrane localization of Rab GTPases.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | COPII-coated ER to Golgi transport vesicle | |
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | endoplasmic reticulum-Golgi intermediate compartment | |
Cellular Component | Golgi membrane | |
Biological Process | endoplasmic reticulum to Golgi vesicle-mediated transport | |
Biological Process | protein transport |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein transport protein YIF1
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP53845
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Multi-pass membrane protein
Golgi apparatus membrane ; Multi-pass membrane protein
Note: Also found in ER-derived COPII-coated vesicles.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 2-153 | Cytoplasmic | ||||
Sequence: SYNPYAYATSEQNGVNDRFSHTPQQQRPMQIPRNTPVNGQGNANMNANVNGSGGGFPFQDPRGSMAFQLGQSAFSNFIGQDNFNQFQETVNKATANAAGSQQISTYFQVSTRYVINKLKLILVPFLNGTKNWQRIMDSGNFLPPRDDVNSPD | ||||||
Transmembrane | 154-174 | Helical | ||||
Sequence: MYMPIMGLVTYILIWNTQQGL | ||||||
Topological domain | 175-188 | Lumenal | ||||
Sequence: KGSFNPEDLYYKLS | ||||||
Transmembrane | 189-209 | Helical | ||||
Sequence: STLAFVCLDLLILKLGLYLLI | ||||||
Topological domain | 210-217 | Cytoplasmic | ||||
Sequence: DSKIPSFS | ||||||
Transmembrane | 218-238 | Helical | ||||
Sequence: LVELLCYVGYKFVPLILAQLL | ||||||
Topological domain | 239-243 | Lumenal | ||||
Sequence: TNVTM | ||||||
Transmembrane | 244-264 | Helical | ||||
Sequence: PFNLNILIKFYLFIAFGVFLL | ||||||
Topological domain | 265-293 | Cytoplasmic | ||||
Sequence: RSVKFNLLSRSGAEDDDIHVSISKSTVKK | ||||||
Transmembrane | 294-313 | Helical | ||||
Sequence: CNYFLFVYGFIWQNVLMWLM | ||||||
Topological domain | 314 | Lumenal | ||||
Sequence: G |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylserine | ||||
Sequence: S | ||||||
Chain | PRO_0000203381 | 2-314 | Protein transport protein YIF1 | |||
Sequence: SYNPYAYATSEQNGVNDRFSHTPQQQRPMQIPRNTPVNGQGNANMNANVNGSGGGFPFQDPRGSMAFQLGQSAFSNFIGQDNFNQFQETVNKATANAAGSQQISTYFQVSTRYVINKLKLILVPFLNGTKNWQRIMDSGNFLPPRDDVNSPDMYMPIMGLVTYILIWNTQQGLKGSFNPEDLYYKLSSTLAFVCLDLLILKLGLYLLIDSKIPSFSLVELLCYVGYKFVPLILAQLLTNVTMPFNLNILIKFYLFIAFGVFLLRSVKFNLLSRSGAEDDDIHVSISKSTVKKCNYFLFVYGFIWQNVLMWLMG |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Component of the YIP1-YIF1 complex, composed of at least YIF1, YIP1 and YOS1. The complex interacts with the ER to Golgi SNAREs BOS1 and SEC22. Interacts with the YIP1 family members YIP4 and YIP5, and with the Rab GTPases SEC4, YPT1, YPT6, YPT7, YPT10, YPT11, YPT31, YPT32 and YPT52. Interacts with BTN2 and SNX3.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P53845 | BTN2 P53286 | 2 | EBI-28230, EBI-3796 | |
BINARY | P53845 | SEC4 P07560 | 2 | EBI-28230, EBI-16858 | |
BINARY | P53845 | VAM7 P32912 | 3 | EBI-28230, EBI-20232 | |
BINARY | P53845 | VPS17 P32913 | 2 | EBI-28230, EBI-20366 | |
BINARY | P53845 | YIP1 P53039 | 5 | EBI-28230, EBI-25295 | |
BINARY | P53845 | YIP4 P53093 | 2 | EBI-28230, EBI-24124 | |
BINARY | P53845 | YPT1 P01123 | 3 | EBI-28230, EBI-29496 | |
BINARY | P53845 | YPT10 P38146 | 2 | EBI-28230, EBI-29357 | |
BINARY | P53845 | YPT31 P38555 | 3 | EBI-28230, EBI-29379 | |
BINARY | P53845 | YPT32 P51996 | 2 | EBI-28230, EBI-29384 | |
BINARY | P53845 | YPT35 P38815 | 4 | EBI-28230, EBI-24665 | |
BINARY | P53845 | YPT53 P36019 | 2 | EBI-28230, EBI-29415 | |
BINARY | P53845 | YPT7 P32939 | 2 | EBI-28230, EBI-29509 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Sequence
- Sequence statusComplete
- Length314
- Mass (Da)35,498
- Last updated1996-10-01 v1
- Checksum3D1550C65A7D0A92
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X92494 EMBL· GenBank· DDBJ | CAA63234.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z71539 EMBL· GenBank· DDBJ | CAA96170.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006947 EMBL· GenBank· DDBJ | DAA10296.1 EMBL· GenBank· DDBJ | Genomic DNA |