P53266 · SHY1_YEAST
- ProteinCytochrome oxidase assembly protein SHY1
- GeneSHY1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids389 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Required for efficient assembly of cytochrome c oxidase in the mitochondrial inner membrane. Involved in a step that couples MSS51-COX14-dependent regulation of COX1 translation to early steps of cytochrome c oxidase assembly.
Miscellaneous
Present with 623 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Cellular Component | mitochondrial inner membrane | |
Cellular Component | mitochondrion | |
Cellular Component | peroxisome | |
Molecular Function | unfolded protein binding | |
Biological Process | mitochondrial cytochrome c oxidase assembly |
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameCytochrome oxidase assembly protein SHY1
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP53266
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-71 | Mitochondrial matrix | ||||
Sequence: MSLLGARSTYRWFSIAASIPTKNAIGKSTYLLASRNQQYRGIITSTVDWKPIKTGKSPNDDSRRERSFGKK | ||||||
Transmembrane | 72-92 | Helical | ||||
Sequence: IVLGLMFAMPIISFYLGTWQV | ||||||
Topological domain | 93-341 | Mitochondrial intermembrane | ||||
Sequence: RRLKWKTKLIAACETKLTYEPIPLPKSFTPDMCEDWEYRKVILTGHFLHNEEMFVGPRKKNGEKGYFLFTPFIRDDTGEKVLIERGWISEEKVAPDSRNLHHLSLPQEEHLKVVCLVRPPKKRGSLQWAKKDPNSRLWQVPDIYDMARSSGCTPIQFQALYDMKDHPIIEEHTRNEASQNNSTSSLWKFWKREPTTAVNGTQAVDNNTSKPRSRQEMPTDQTIEFDERQFIKAGVPIGRKPTIDLKNNH | ||||||
Transmembrane | 342-362 | Helical | ||||
Sequence: LQYLVTWYGLSFLSTIFLIVA | ||||||
Topological domain | 363-389 | Mitochondrial matrix | ||||
Sequence: LRKAKRGGVVSQDQLMKEKLKHSRKYM |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000215659 | 1-389 | Cytochrome oxidase assembly protein SHY1 | |||
Sequence: MSLLGARSTYRWFSIAASIPTKNAIGKSTYLLASRNQQYRGIITSTVDWKPIKTGKSPNDDSRRERSFGKKIVLGLMFAMPIISFYLGTWQVRRLKWKTKLIAACETKLTYEPIPLPKSFTPDMCEDWEYRKVILTGHFLHNEEMFVGPRKKNGEKGYFLFTPFIRDDTGEKVLIERGWISEEKVAPDSRNLHHLSLPQEEHLKVVCLVRPPKKRGSLQWAKKDPNSRLWQVPDIYDMARSSGCTPIQFQALYDMKDHPIIEEHTRNEASQNNSTSSLWKFWKREPTTAVNGTQAVDNNTSKPRSRQEMPTDQTIEFDERQFIKAGVPIGRKPTIDLKNNHLQYLVTWYGLSFLSTIFLIVALRKAKRGGVVSQDQLMKEKLKHSRKYM |
Proteomic databases
Interaction
Subunit
Interacts with COA1, COX14 and MSS51.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P53266 | COA1 P40452 | 5 | EBI-17111, EBI-25287 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 292-308 | Polar residues | ||||
Sequence: GTQAVDNNTSKPRSRQE | ||||||
Region | 292-311 | Disordered | ||||
Sequence: GTQAVDNNTSKPRSRQEMPT |
Sequence similarities
Belongs to the SURF1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length389
- Mass (Da)45,056
- Last updated1996-10-01 v1
- Checksum2C95E607B7507321
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 292-308 | Polar residues | ||||
Sequence: GTQAVDNNTSKPRSRQE |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z72897 EMBL· GenBank· DDBJ | CAA97120.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006941 EMBL· GenBank· DDBJ | DAA08206.1 EMBL· GenBank· DDBJ | Genomic DNA |