P53217 · YG1I_YEAST
- ProteinUncharacterized membrane protein YGR026W
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids278 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell periphery | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | plasma membrane | |
Biological Process | endoplasmic reticulum tubular network organization | |
Biological Process | membrane organization |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameUncharacterized membrane protein YGR026W
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP53217
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-34 | Cytoplasmic | ||||
Sequence: MAKTIKVIRKKDPKKKNLSDPLAKQKLVWKIGHV | ||||||
Transmembrane | 35-55 | Helical | ||||
Sequence: LTLVFGLLFSITYFYHVLIFF | ||||||
Topological domain | 56-129 | Extracellular | ||||
Sequence: KYRSWKWLFLRVNKNYSFIQSKRWYMKLLSWSPQVMYRLSLIGVFMSESVTMQQNWVGLNPTWNDLLSSENFHT | ||||||
Transmembrane | 130-150 | Helical | ||||
Sequence: LLIACLWFFGGGKSFYKILPY | ||||||
Topological domain | 151-180 | Cytoplasmic | ||||
Sequence: MILSYLHLTKMNYELNANKEEKIPLTPKDR | ||||||
Transmembrane | 181-201 | Helical | ||||
Sequence: KMLHLLAYSELLVILALTLDT | ||||||
Topological domain | 202-205 | Extracellular | ||||
Sequence: ILFK | ||||||
Transmembrane | 206-222 | Helical | ||||
Sequence: TGTSGFMLVIYVGIYWL | ||||||
Topological domain | 223-278 | Cytoplasmic | ||||
Sequence: RLNFSPYAQVAVLELLVKFEKYVPKKYRDKWQVIKNFIYMKMKEHEKRTEEVARYA |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000202790 | 1-278 | Uncharacterized membrane protein YGR026W | |||
Sequence: MAKTIKVIRKKDPKKKNLSDPLAKQKLVWKIGHVLTLVFGLLFSITYFYHVLIFFKYRSWKWLFLRVNKNYSFIQSKRWYMKLLSWSPQVMYRLSLIGVFMSESVTMQQNWVGLNPTWNDLLSSENFHTLLIACLWFFGGGKSFYKILPYMILSYLHLTKMNYELNANKEEKIPLTPKDRKMLHLLAYSELLVILALTLDTILFKTGTSGFMLVIYVGIYWLRLNFSPYAQVAVLELLVKFEKYVPKKYRDKWQVIKNFIYMKMKEHEKRTEEVARYA |
Proteomic databases
Structure
Sequence
- Sequence statusComplete
- Length278
- Mass (Da)33,255
- Last updated1996-10-01 v1
- Checksum55FA21585CD3FAA1
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z72811 EMBL· GenBank· DDBJ | CAA97009.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006941 EMBL· GenBank· DDBJ | DAA08120.1 EMBL· GenBank· DDBJ | Genomic DNA |