P53044 · UFD1_YEAST
- ProteinUbiquitin fusion degradation protein 1
- GeneUFD1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids361 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Functions at a post-ubiquitation step in the ubiquitin fusion degradation (UFD) pathway. Has a role in the endoplasmic reticulum-associated degradation (ERAD) pathway. Required for the proteasome-dependent processing/activation of MGA2 and SPT23 transcription factors leading to the subsequent expression of OLE1. Has an additional role in the turnover of OLE1 where it targets ubiquitinated OLE1 and other proteins to the ERAD.
Miscellaneous
Present with 3530 molecules/cell in log phase SD medium.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 37 | Monoubiquitin-binding | ||||
Sequence: I | ||||||
Site | 39 | Monoubiquitin-binding | ||||
Sequence: K | ||||||
Site | 109 | Monoubiquitin-binding | ||||
Sequence: G |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameUbiquitin fusion degradation protein 1
- Short namesUB fusion protein 1
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP53044
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 94 | In UFD1-1; grows more slowly. | ||||
Sequence: V → D |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 3 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000194989 | 1-361 | Ubiquitin fusion degradation protein 1 | |||
Sequence: MFSGFSSFGGGNGFVNMPQTFEEFFRCYPIAMMNDRIRKDDANFGGKIFLPPSALSKLSMLNIRYPMLFKLTANETGRVTHGGVLEFIAEEGRVYLPQWMMETLGIQPGSLLQISSTDVPLGQFVKLEPQSVDFLDISDPKAVLENVLRNFSTLTVDDVIEISYNGKTFKIKILEVKPESSSKSICVIETDLVTDFAPPVGYVEPDYKALKAQQDKEKKNSFGKGQVLDPSVLGQGSMSTRIDYAGIANSSRNKLSKFVGQGQNISGKAPKAEPKQDIKDMKITFDGEPAKLDLPEGQLFFGFPMVLPKEDEESAAGSKSSEQNFQGQGISLRKSNKRKTKSDHDSSKSKAPKSPEVIEID | ||||||
Modified residue | 354 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Component of the heterotrimeric CDC48-NPL4-UFD1 ATPase complex (PubMed:16873066).
The CDC48-NPL4-UFD1 ATPase complex interacts with the HRD1 ubiquitin ligase complex composed of the E3 ligase HRD1, its cofactors HRD3, USA1 and DER1, substrate recruiting factor YOS9 and CDC48-binding protein UBX2 (PubMed:16873066).
Interaction between the complexes is mediated by interaction between CDC48-NPL4-UFD1 complex member CDC48 and HRD1 complex member UBX2 (PubMed:16873066).
Forms a complex composed of CDC48, NPL4, UFD1, DOA1, SHP1 and deubiquitinase OTU1 (PubMed:16427015).
Interacts with NPL4, CDC48 and UBX2 (PubMed:11598205, PubMed:11733065, PubMed:16873066).
The CDC48-NPL4-UFD1 ATPase complex interacts with the HRD1 ubiquitin ligase complex composed of the E3 ligase HRD1, its cofactors HRD3, USA1 and DER1, substrate recruiting factor YOS9 and CDC48-binding protein UBX2 (PubMed:16873066).
Interaction between the complexes is mediated by interaction between CDC48-NPL4-UFD1 complex member CDC48 and HRD1 complex member UBX2 (PubMed:16873066).
Forms a complex composed of CDC48, NPL4, UFD1, DOA1, SHP1 and deubiquitinase OTU1 (PubMed:16427015).
Interacts with NPL4, CDC48 and UBX2 (PubMed:11598205, PubMed:11733065, PubMed:16873066).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P53044 | CDC48 P25694 | 14 | EBI-19997, EBI-4308 | |
BINARY | P53044 | DER1 P38307 | 3 | EBI-19997, EBI-5761 | |
BINARY | P53044 | NPL4 P33755 | 12 | EBI-19997, EBI-12193 | |
BINARY | P53044 | RAD52 P06778 | 4 | EBI-19997, EBI-14719 | |
BINARY | P53044 | SMT3 Q12306 | 3 | EBI-19997, EBI-17490 | |
BINARY | P53044 | UBX2 Q04228 | 6 | EBI-19997, EBI-27730 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 27-28 | Monoubiquitin-binding | ||||
Sequence: CY | ||||||
Region | 30-32 | Monoubiquitin-binding | ||||
Sequence: IAM | ||||||
Region | 99-101 | Monoubiquitin-binding | ||||
Sequence: WMM | ||||||
Region | 310-361 | Disordered | ||||
Sequence: EDEESAAGSKSSEQNFQGQGISLRKSNKRKTKSDHDSSKSKAPKSPEVIEID | ||||||
Compositional bias | 318-333 | Polar residues | ||||
Sequence: SKSSEQNFQGQGISLR | ||||||
Compositional bias | 336-361 | Basic and acidic residues | ||||
Sequence: NKRKTKSDHDSSKSKAPKSPEVIEID |
Sequence similarities
Belongs to the UFD1 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length361
- Mass (Da)39,810
- Last updated1996-10-01 v1
- Checksum198E0CD48B863B98
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 318-333 | Polar residues | ||||
Sequence: SKSSEQNFQGQGISLR | ||||||
Compositional bias | 336-361 | Basic and acidic residues | ||||
Sequence: NKRKTKSDHDSSKSKAPKSPEVIEID |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U22153 EMBL· GenBank· DDBJ | AAC49023.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U17264 EMBL· GenBank· DDBJ | AAB46627.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ115391 EMBL· GenBank· DDBJ | AAZ22463.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z72833 EMBL· GenBank· DDBJ | CAA97047.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY692806 EMBL· GenBank· DDBJ | AAT92825.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006941 EMBL· GenBank· DDBJ | DAA08146.1 EMBL· GenBank· DDBJ | Genomic DNA |