P52955 · LBX1_MOUSE
- ProteinTranscription factor LBX1
- GeneLbx1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids282 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription factor required for the development of GABAergic interneurons in the dorsal horn of the spinal cord and migration and further development of hypaxial muscle precursor cells for limb muscles, diaphragm and hypoglossal cord.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 125-184 | Homeobox | ||||
Sequence: RRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDL |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Cellular Component | transcription regulator complex | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | sequence-specific double-stranded DNA binding | |
Biological Process | cell population proliferation | |
Biological Process | glutamatergic neuron differentiation | |
Biological Process | heart looping | |
Biological Process | muscle organ development | |
Biological Process | negative regulation of cell population proliferation | |
Biological Process | negative regulation of glutamatergic neuron differentiation | |
Biological Process | neuron fate commitment | |
Biological Process | neuron fate determination | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | regulation of transcription by RNA polymerase II | |
Biological Process | spinal cord motor neuron differentiation |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameTranscription factor LBX1
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP52955
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Death at birth. Mice fail to expand their lungs and do not move their abnormally thin limbs.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 2 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000049167 | 1-282 | Transcription factor LBX1 | |||
Sequence: MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAPGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEASGGGGGGGCGRAKSRPGSPALPPGAPQAPGGGPLQLSPASPLTDQRASSQDCSEDEEDEEIDVDD |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the dorsal part of the spinal cord and hindbrain and in presumptive myogenic cells in lateral regions of differentiating somites.
Developmental stage
Expressed in the developing central nervous system from 10.5 dpc to 16.5 dpc. Expressed in presumptive myogenic cells from 9.5 dpc until 16.5 dpc with highest levels at 10.5-11.5 dpc.
Gene expression databases
Interaction
Subunit
Interacts with SKOR1 which acts as a transcriptional corepressor.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P52955 | Skor1 Q8BX46 | 2 | EBI-604594, EBI-604451 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-21 | Basic and acidic residues | ||||
Sequence: MTSKEDGKAAPGEERRRSPLD | ||||||
Region | 1-36 | Disordered | ||||
Sequence: MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPF | ||||||
Region | 210-282 | Disordered | ||||
Sequence: ELEQNSEASGGGGGGGCGRAKSRPGSPALPPGAPQAPGGGPLQLSPASPLTDQRASSQDCSEDEEDEEIDVDD | ||||||
Compositional bias | 268-282 | Acidic residues | ||||
Sequence: DCSEDEEDEEIDVDD |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length282
- Mass (Da)30,262
- Last updated2006-11-14 v2
- Checksum3A4A80CD47B0228C
Sequence caution
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-21 | Basic and acidic residues | ||||
Sequence: MTSKEDGKAAPGEERRRSPLD | ||||||
Sequence conflict | 33-72 | in Ref. 1; CAA62343 | ||||
Sequence: LTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAPGGLP → YAVQHRGHPQQAVRAEKLLAVWGGAPAGGRGQARAGRLA | ||||||
Sequence conflict | 225 | in Ref. 1; CAA62343 | ||||
Sequence: Missing | ||||||
Compositional bias | 268-282 | Acidic residues | ||||
Sequence: DCSEDEEDEEIDVDD |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X90829 EMBL· GenBank· DDBJ | CAA62343.1 EMBL· GenBank· DDBJ | mRNA | ||
AB108497 EMBL· GenBank· DDBJ | BAC75634.1 EMBL· GenBank· DDBJ | mRNA | ||
BC119177 EMBL· GenBank· DDBJ | AAI19178.1 EMBL· GenBank· DDBJ | mRNA | ||
BC120586 EMBL· GenBank· DDBJ | AAI20587.1 EMBL· GenBank· DDBJ | mRNA | ||
AK144562 EMBL· GenBank· DDBJ | BAE25939.1 EMBL· GenBank· DDBJ | mRNA | Different initiation |