P52952 · NKX25_HUMAN
- ProteinHomeobox protein Nkx-2.5
- GeneNKX2-5
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids324 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
During heart development, acts as a transcriptional activator of NPPA/ANF in cooperation with GATA4 (By similarity).
May cooperate with TBX2 to negatively modulate expression of NPPA/ANF in the atrioventricular canal (By similarity).
Binds to the core DNA motif of NPPA promoter (PubMed:22849347, PubMed:26926761).
Together with PBX1, required for spleen development through a mechanism that involves CDKN2B repression (PubMed:22560297).
Positively regulates transcription of genes such as COL3A1 and MMP2, resulting in increased pulmonary endothelial fibrosis in response to hypoxia (PubMed:29899023).
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 138-197 | Homeobox | ||||
Sequence: RRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQR |
GO annotations
Keywords
- Molecular function
Enzyme and pathway databases
The subsequence DNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGL, which contains the Homeodomain domain, shows transcriptional repressor activity in a high-throughput recruitment assay.
Names & Taxonomy
Protein names
- Recommended nameHomeobox protein Nkx-2.5
- Alternative names
Gene names
- Community suggested namesNKX2-5
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP52952
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Involvement in disease
Atrial septal defect 7, with or without atrioventricular conduction defects (ASD7)
- Note
- DescriptionA congenital heart malformation characterized by incomplete closure of the wall between the atria resulting in blood flow from the left to the right atria, and atrioventricular conduction defects in some cases.
- See alsoMIM:108900
Natural variants in ASD7
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_038212 | 7 | L>P | in ASD7; somatic mutation | |
VAR_038213 | 15 | K>I | in ASD7; dbSNP:rs387906773 | |
VAR_038214 | 19 | N>S | in ASD7; somatic mutation | |
VAR_038215 | 21 | E>Q | in TOF and ASD7; dbSNP:rs104893904 | |
VAR_038216 | 22 | Q>P | in ASD7 and TOF; dbSNP:rs201442000 | |
VAR_010116 | 25 | R>C | in ASD7, TOF, CHNG5, HLHS2 and CTHM; uncertain significance; exhibits significant functional impairment with reduction of transactivation properties and dominant-negative effect; the mutant protein activity on the DIO2, TG and TPO promoters is significantly impaired; dbSNP:rs28936670 | |
VAR_038217 | 45 | S>P | in ASD7; somatic mutation; dbSNP:rs779548360 | |
VAR_038218 | 51 | F>L | in ASD7; somatic mutation; dbSNP:rs753937287 | |
VAR_038219 | 63 | A>V | in ASD7; dbSNP:rs530270916 | |
VAR_038220 | 69 | L>P | in ASD7; somatic mutation | |
VAR_038221 | 77 | P>L | in ASD7; somatic mutation | |
VAR_038222 | 114 | C>R | in ASD7; somatic mutation | |
VAR_038223 | 114 | C>S | in ASD7; somatic mutation | |
VAR_038224 | 118 | K>R | in ASD7; somatic mutation | |
VAR_038225 | 124 | K>R | in ASD7; somatic mutation | |
VAR_038226 | 126 | E>V | in ASD7; somatic mutation | |
VAR_038227 | 127 | A>E | in ASD7; dbSNP:rs387906774 | |
VAR_038228 | 133 | P>S | in ASD7; somatic mutation; dbSNP:rs1184594159 | |
VAR_038229 | 135 | A>T | in ASD7; somatic mutation; dbSNP:rs1761363121 | |
VAR_038230 | 142 | R>C | in ASD7 | |
VAR_038231 | 144 | L>P | in ASD7; somatic mutation; dbSNP:rs747932354 | |
VAR_003752 | 178 | T>M | in ASD7; dbSNP:rs104893900 | |
VAR_038232 | 183 | K>E | in ASD7; somatic mutation; dbSNP:rs137852686 | |
VAR_038233 | 187 | Q>H | in ASD7 | |
VAR_010117 | 188 | N>K | in ASD7 | |
VAR_010118 | 189 | R>G | in ASD7 | |
VAR_038234 | 190 | R>C | in ASD7; dbSNP:rs104893906 | |
VAR_010119 | 191 | Y>C | in ASD7 | |
VAR_038235 | 192 | K>R | in ASD7; somatic mutation | |
VAR_038236 | 192 | K>T | in ASD7; somatic mutation | |
VAR_038237 | 194 | K>R | in ASD7; somatic mutation | |
VAR_038238 | 205 | V>E | in ASD7; somatic mutation | |
VAR_038239 | 216 | R>C | in TOF and ASD7; dbSNP:rs104893905 | |
VAR_038240 | 219 | A>V | in ASD7 and TOF; somatic mutation; dbSNP:rs104893902 | |
VAR_038241 | 226 | D>N | in ASD7; somatic mutation; dbSNP:rs760528062 | |
VAR_038242 | 248 | Y>H | in ASD7; somatic mutation | |
VAR_038243 | 275 | P>T | in ASD7; dbSNP:rs368366482 | |
VAR_038244 | 279 | S>F | in ASD7; somatic mutation; dbSNP:rs1223599871 | |
VAR_038245 | 279 | S>P | in ASD7; somatic mutation | |
VAR_038246 | 281 | A>V | in ASD7; somatic mutation | |
VAR_038247 | 286 | A>V | in ASD7; somatic mutation | |
VAR_038248 | 294 | N>H | in ASD7; somatic mutation | |
VAR_038249 | 299 | D>G | in ASD7; somatic mutation; dbSNP:rs137852683 | |
VAR_038250 | 305 | S>G | in ASD7; somatic mutation | |
VAR_038251 | 320 | G>S | in ASD7; somatic mutation; dbSNP:rs1761339592 | |
VAR_038252 | 322 | R>Q | in ASD7; somatic mutation | |
VAR_038253 | 323 | A>T | in ASD7 and TOF |
Tetralogy of Fallot (TOF)
- Note
- DescriptionA congenital heart anomaly which consists of pulmonary stenosis, ventricular septal defect, dextroposition of the aorta (aorta is on the right side instead of the left) and hypertrophy of the right ventricle. In this condition, blood from both ventricles (oxygen-rich and oxygen-poor) is pumped into the body often causing cyanosis.
- See alsoMIM:187500
Natural variants in TOF
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_038215 | 21 | E>Q | in TOF and ASD7; dbSNP:rs104893904 | |
VAR_038216 | 22 | Q>P | in ASD7 and TOF; dbSNP:rs201442000 | |
VAR_010116 | 25 | R>C | in ASD7, TOF, CHNG5, HLHS2 and CTHM; uncertain significance; exhibits significant functional impairment with reduction of transactivation properties and dominant-negative effect; the mutant protein activity on the DIO2, TG and TPO promoters is significantly impaired; dbSNP:rs28936670 | |
VAR_038239 | 216 | R>C | in TOF and ASD7; dbSNP:rs104893905 | |
VAR_038240 | 219 | A>V | in ASD7 and TOF; somatic mutation; dbSNP:rs104893902 | |
VAR_038253 | 323 | A>T | in ASD7 and TOF |
Conotruncal heart malformations (CTHM)
- Note
- DescriptionA group of congenital heart defects involving the outflow tracts. Examples include truncus arteriosus communis, double-outlet right ventricle and transposition of great arteries. Truncus arteriosus communis is characterized by a single outflow tract instead of a separate aorta and pulmonary artery. In transposition of the great arteries, the aorta arises from the right ventricle and the pulmonary artery from the left ventricle. In double outlet of the right ventricle, both the pulmonary artery and aorta arise from the right ventricle.
- See alsoMIM:217095
Natural variants in CTHM
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_010116 | 25 | R>C | in ASD7, TOF, CHNG5, HLHS2 and CTHM; uncertain significance; exhibits significant functional impairment with reduction of transactivation properties and dominant-negative effect; the mutant protein activity on the DIO2, TG and TPO promoters is significantly impaired; dbSNP:rs28936670 |
Hypothyroidism, congenital, non-goitrous, 5 (CHNG5)
- Note
- DescriptionA non-autoimmune condition characterized by resistance to thyroid-stimulating hormone (TSH) leading to increased levels of plasma TSH and low levels of thyroid hormone. CHNG5 presents variable severity depending on the completeness of the defect. Most patients are euthyroid and asymptomatic, with a normal sized thyroid gland. Only a subset of patients develop hypothyroidism and present a hypoplastic thyroid gland.
- See alsoMIM:225250
Natural variants in CHNG5
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_010116 | 25 | R>C | in ASD7, TOF, CHNG5, HLHS2 and CTHM; uncertain significance; exhibits significant functional impairment with reduction of transactivation properties and dominant-negative effect; the mutant protein activity on the DIO2, TG and TPO promoters is significantly impaired; dbSNP:rs28936670 | |
VAR_047869 | 119 | A>S | in CHNG5; exhibits a significant functional impairment with reduction of transactivation properties and dominant-negative effect which was associated with reduced DNA binding; dbSNP:rs137852684 | |
VAR_047870 | 161 | R>P | in CHNG5; exhibits a significant functional impairment with reduction of transactivation properties and dominant-negative effect which was associated with reduced DNA binding; dbSNP:rs137852685 |
Ventricular septal defect 3 (VSD3)
- Note
- DescriptionA common form of congenital cardiovascular anomaly that may occur alone or in combination with other cardiac malformations. It can affect any portion of the ventricular septum, resulting in abnormal communications between the two lower chambers of the heart. Classification is based on location of the communication, such as perimembranous, inlet, outlet (infundibular), central muscular, marginal muscular, or apical muscular defect. Large defects that go unrepaired may give rise to cardiac enlargement, congestive heart failure, pulmonary hypertension, Eisenmenger's syndrome, delayed fetal brain development, arrhythmias, and even sudden cardiac death.
- See alsoMIM:614432
Natural variants in VSD3
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_067586 | 59 | P>A | in VSD3; significantly reduced activation of NPPA gene compared to wild-type; dbSNP:rs387906775 | |
VAR_067587 | 283 | P>Q | in VSD3; dbSNP:rs375086983 |
Hypoplastic left heart syndrome 2 (HLHS2)
- Note
- DescriptionA syndrome due to defective development of the aorta proximal to the entrance of the ductus arteriosus, and hypoplasia of the left ventricle and mitral valve. As a result of the abnormal circulation, the ductus arteriosus and foramen ovale are patent and the right atrium, right ventricle, and pulmonary artery are enlarged.
- See alsoMIM:614435
Natural variants in HLHS2
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_010116 | 25 | R>C | in ASD7, TOF, CHNG5, HLHS2 and CTHM; uncertain significance; exhibits significant functional impairment with reduction of transactivation properties and dominant-negative effect; the mutant protein activity on the DIO2, TG and TPO promoters is significantly impaired; dbSNP:rs28936670 |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_038212 | 7 | in ASD7; somatic mutation | |||
Sequence: L → P | ||||||
Natural variant | VAR_038213 | 15 | in ASD7; dbSNP:rs387906773 | |||
Sequence: K → I | ||||||
Natural variant | VAR_049581 | 16 | in dbSNP:rs17052019 | |||
Sequence: D → A | ||||||
Natural variant | VAR_038214 | 19 | in ASD7; somatic mutation | |||
Sequence: N → S | ||||||
Natural variant | VAR_038215 | 21 | in TOF and ASD7; dbSNP:rs104893904 | |||
Sequence: E → Q | ||||||
Natural variant | VAR_038216 | 22 | in ASD7 and TOF; dbSNP:rs201442000 | |||
Sequence: Q → P | ||||||
Natural variant | VAR_010116 | 25 | in ASD7, TOF, CHNG5, HLHS2 and CTHM; uncertain significance; exhibits significant functional impairment with reduction of transactivation properties and dominant-negative effect; the mutant protein activity on the DIO2, TG and TPO promoters is significantly impaired; dbSNP:rs28936670 | |||
Sequence: R → C | ||||||
Natural variant | VAR_038217 | 45 | in ASD7; somatic mutation; dbSNP:rs779548360 | |||
Sequence: S → P | ||||||
Natural variant | VAR_038218 | 51 | in ASD7; somatic mutation; dbSNP:rs753937287 | |||
Sequence: F → L | ||||||
Natural variant | VAR_067586 | 59 | in VSD3; significantly reduced activation of NPPA gene compared to wild-type; dbSNP:rs387906775 | |||
Sequence: P → A | ||||||
Natural variant | VAR_038219 | 63 | in ASD7; dbSNP:rs530270916 | |||
Sequence: A → V | ||||||
Natural variant | VAR_038220 | 69 | in ASD7; somatic mutation | |||
Sequence: L → P | ||||||
Natural variant | VAR_069058 | 74 | in dbSNP:rs201362118 | |||
Sequence: G → D | ||||||
Natural variant | VAR_038221 | 77 | in ASD7; somatic mutation | |||
Sequence: P → L | ||||||
Natural variant | VAR_038222 | 114 | in ASD7; somatic mutation | |||
Sequence: C → R | ||||||
Natural variant | VAR_038223 | 114 | in ASD7; somatic mutation | |||
Sequence: C → S | ||||||
Natural variant | VAR_038224 | 118 | in ASD7; somatic mutation | |||
Sequence: K → R | ||||||
Natural variant | VAR_047869 | 119 | in CHNG5; exhibits a significant functional impairment with reduction of transactivation properties and dominant-negative effect which was associated with reduced DNA binding; dbSNP:rs137852684 | |||
Sequence: A → S | ||||||
Natural variant | VAR_038225 | 124 | in ASD7; somatic mutation | |||
Sequence: K → R | ||||||
Natural variant | VAR_038226 | 126 | in ASD7; somatic mutation | |||
Sequence: E → V | ||||||
Natural variant | VAR_038227 | 127 | in ASD7; dbSNP:rs387906774 | |||
Sequence: A → E | ||||||
Natural variant | VAR_038228 | 133 | in ASD7; somatic mutation; dbSNP:rs1184594159 | |||
Sequence: P → S | ||||||
Natural variant | VAR_038229 | 135 | in ASD7; somatic mutation; dbSNP:rs1761363121 | |||
Sequence: A → T | ||||||
Natural variant | VAR_038230 | 142 | in ASD7 | |||
Sequence: R → C | ||||||
Natural variant | VAR_038231 | 144 | in ASD7; somatic mutation; dbSNP:rs747932354 | |||
Sequence: L → P | ||||||
Natural variant | VAR_047870 | 161 | in CHNG5; exhibits a significant functional impairment with reduction of transactivation properties and dominant-negative effect which was associated with reduced DNA binding; dbSNP:rs137852685 | |||
Sequence: R → P | ||||||
Natural variant | VAR_003752 | 178 | in ASD7; dbSNP:rs104893900 | |||
Sequence: T → M | ||||||
Natural variant | VAR_038232 | 183 | in ASD7; somatic mutation; dbSNP:rs137852686 | |||
Sequence: K → E | ||||||
Natural variant | VAR_038233 | 187 | in ASD7 | |||
Sequence: Q → H | ||||||
Natural variant | VAR_010117 | 188 | in ASD7 | |||
Sequence: N → K | ||||||
Natural variant | VAR_010118 | 189 | in ASD7 | |||
Sequence: R → G | ||||||
Natural variant | VAR_038234 | 190 | in ASD7; dbSNP:rs104893906 | |||
Sequence: R → C | ||||||
Natural variant | VAR_010119 | 191 | in ASD7 | |||
Sequence: Y → C | ||||||
Natural variant | VAR_038235 | 192 | in ASD7; somatic mutation | |||
Sequence: K → R | ||||||
Natural variant | VAR_038236 | 192 | in ASD7; somatic mutation | |||
Sequence: K → T | ||||||
Natural variant | VAR_038237 | 194 | in ASD7; somatic mutation | |||
Sequence: K → R | ||||||
Natural variant | VAR_038238 | 205 | in ASD7; somatic mutation | |||
Sequence: V → E | ||||||
Natural variant | VAR_038239 | 216 | in TOF and ASD7; dbSNP:rs104893905 | |||
Sequence: R → C | ||||||
Natural variant | VAR_038240 | 219 | in ASD7 and TOF; somatic mutation; dbSNP:rs104893902 | |||
Sequence: A → V | ||||||
Natural variant | VAR_038241 | 226 | in ASD7; somatic mutation; dbSNP:rs760528062 | |||
Sequence: D → N | ||||||
Natural variant | VAR_069590 | 236 | found in patients with isolated congenital asplenia; uncertain significance; does not affect DNA binding; impairs transactivation activity; dbSNP:rs397515399 | |||
Sequence: P → H | ||||||
Natural variant | VAR_038242 | 248 | in ASD7; somatic mutation | |||
Sequence: Y → H | ||||||
Natural variant | VAR_038243 | 275 | in ASD7; dbSNP:rs368366482 | |||
Sequence: P → T | ||||||
Natural variant | VAR_038244 | 279 | in ASD7; somatic mutation; dbSNP:rs1223599871 | |||
Sequence: S → F | ||||||
Natural variant | VAR_038245 | 279 | in ASD7; somatic mutation | |||
Sequence: S → P | ||||||
Natural variant | VAR_038246 | 281 | in ASD7; somatic mutation | |||
Sequence: A → V | ||||||
Natural variant | VAR_067587 | 283 | in VSD3; dbSNP:rs375086983 | |||
Sequence: P → Q | ||||||
Natural variant | VAR_038247 | 286 | in ASD7; somatic mutation | |||
Sequence: A → V | ||||||
Natural variant | VAR_067588 | 291 | in CTMH; dbSNP:rs756974215 | |||
Sequence: Missing | ||||||
Natural variant | VAR_038248 | 294 | in ASD7; somatic mutation | |||
Sequence: N → H | ||||||
Natural variant | VAR_038249 | 299 | in ASD7; somatic mutation; dbSNP:rs137852683 | |||
Sequence: D → G | ||||||
Natural variant | VAR_038250 | 305 | in ASD7; somatic mutation | |||
Sequence: S → G | ||||||
Natural variant | VAR_038251 | 320 | in ASD7; somatic mutation; dbSNP:rs1761339592 | |||
Sequence: G → S | ||||||
Natural variant | VAR_038252 | 322 | in ASD7; somatic mutation | |||
Sequence: R → Q | ||||||
Natural variant | VAR_038253 | 323 | in ASD7 and TOF | |||
Sequence: A → T |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 579 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000048937 | 1-324 | UniProt | Homeobox protein Nkx-2.5 | |||
Sequence: MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW | |||||||
Modified residue (large scale data) | 78 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
PTM databases
Expression
Tissue specificity
Developmental stage
Expressed by all myocardial cells at embryonic stages 10 to 11 (at protein level) (PubMed:21403123).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts (via the homeobox) with TBX5 (via the T-box); this complex binds DNA (PubMed:26926761).
Interacts with HIPK1 and HIPK2, but not HIPK3. Interacts with the C-terminal zinc finger of GATA4 through its homeobox domain. Also interacts with JARID2 which represses its ability to activate transcription of ANF. Interacts with FBLIM1. Interacts with TBX18 (By similarity).
Interacts with histone methyltransferase NSD2 (via HMG box) (By similarity).
Interacts with NEDD9 (PubMed:29899023).
Interacts with TBX1 (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
XENO | P52952 | Fblim1 Q71FD7 | 4 | EBI-936601, EBI-8346526 | |
BINARY | P52952 | GATA4 P43694 | 2 | EBI-936601, EBI-7049352 | |
BINARY | P52952 | KRTAP8-1 Q8IUC2 | 3 | EBI-936601, EBI-10261141 | |
BINARY | P52952 | RBPMS Q93062-3 | 3 | EBI-936601, EBI-740343 | |
BINARY | P52952 | SHOX O15266-2 | 3 | EBI-936601, EBI-12825957 | |
BINARY | P52952 | TBX5 Q99593-1 | 6 | EBI-936601, EBI-304423 | |
BINARY | P52952 | TRIP10 Q15642-2 | 3 | EBI-936601, EBI-6550597 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Domain
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
P52952-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length324
- Mass (Da)34,918
- Last updated1996-10-01 v1
- ChecksumACCC9C2F9C292586
P52952-2
- Name2
P52952-3
- Name3
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
E5RH49 | E5RH49_HUMAN | NKX2-5 | 142 |
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_045481 | 112 | in isoform 3 | |||
Sequence: E → A | ||||||
Alternative sequence | VSP_043492 | 112-151 | in isoform 2 | |||
Sequence: ELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVY → GCELPRGQRPPVLFSSALSQPDFLQMLSETCRWLPVHLAE | ||||||
Alternative sequence | VSP_045482 | 113-324 | in isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_043493 | 152-324 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U34962 EMBL· GenBank· DDBJ | AAC50470.1 EMBL· GenBank· DDBJ | mRNA | ||
AB021133 EMBL· GenBank· DDBJ | BAA35181.1 EMBL· GenBank· DDBJ | mRNA | ||
AK297844 EMBL· GenBank· DDBJ | BAG60178.1 EMBL· GenBank· DDBJ | mRNA | ||
AK290615 EMBL· GenBank· DDBJ | BAF83304.1 EMBL· GenBank· DDBJ | mRNA | ||
AK309495 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
AC008412 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471062 EMBL· GenBank· DDBJ | EAW61404.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC025711 EMBL· GenBank· DDBJ | AAH25711.1 EMBL· GenBank· DDBJ | mRNA |