P52654 · TF2AA_DROME
- ProteinTranscription initiation factor IIA subunit 1
- GeneTfIIA-L
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids366 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Cellular Component | transcription factor TFIIA complex | |
Molecular Function | TBP-class protein binding | |
Molecular Function | TFIID-class transcription factor complex binding | |
Biological Process | transcription by RNA polymerase II | |
Biological Process | transcription initiation at RNA polymerase II promoter |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTranscription initiation factor IIA subunit 1
- Alternative names
- Cleaved into 2 chains
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionP52654
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000042591 | 1-262 | Transcription initiation factor IIA alpha chain | |||
Sequence: MALCQTSVLKVYHAVIEDVITNVRDAFLDEGVDEQVLQEMKQVWRNKLLASKAVELSPDSGDGSHPPPIVANNPKSHKAANAKAKKAAAATAVTSHQHIGGNSSMSSLVGLKSSAGMAAGSGIRNGLVPIKQEVNSQNPPPLHPTSAASMMQKQQQAASSGQGSIPIVATLDPNRIMPVNITLPSPAGSASSESRVLTIQVPASALQENQLTQILTAHLISSIMSLPTTLASSVLQQHVNAALSSANHQKTLAAAKQLDGAL | ||||||
Chain | PRO_0000042590 | 1-366 | Transcription initiation factor IIA subunit 1 | |||
Sequence: MALCQTSVLKVYHAVIEDVITNVRDAFLDEGVDEQVLQEMKQVWRNKLLASKAVELSPDSGDGSHPPPIVANNPKSHKAANAKAKKAAAATAVTSHQHIGGNSSMSSLVGLKSSAGMAAGSGIRNGLVPIKQEVNSQNPPPLHPTSAASMMQKQQQAASSGQGSIPIVATLDPNRIMPVNITLPSPAGSASSESRVLTIQVPASALQENQLTQILTAHLISSIMSLPTTLASSVLQQHVNAALSSANHQKTLAAAKQLDGALDSSDEDESEESDDNIDNDDDDDLDKDDDEDAEHEDAAEEEPLNSEDDVTDEDSAEMFDTDNVIVCQYDKITRSRNKWKFYLKDGIMNMRGKDYVFQKSNGDAEW | ||||||
Chain | PRO_0000042592 | 263-366 | Transcription initiation factor IIA beta chain | |||
Sequence: DSSDEDESEESDDNIDNDDDDDLDKDDDEDAEHEDAAEEEPLNSEDDVTDEDSAEMFDTDNVIVCQYDKITRSRNKWKFYLKDGIMNMRGKDYVFQKSNGDAEW | ||||||
Modified residue | 265 | Phosphoserine; by TAF1 | ||||
Sequence: S | ||||||
Modified residue | 306 | Phosphoserine; by TAF1 | ||||
Sequence: S |
Post-translational modification
The precursor form (48 kDa) is cleaved to give rise to the alpha (30 kDa) and beta (20 kDa) subunits.
Keywords
- PTM
Proteomic databases
Expression
Gene expression databases
Interaction
Subunit
Belongs to the TFIID complex which is composed of TATA binding protein (Tbp) and a number of TBP-associated factors (Tafs). TFIIA is a heterodimer of a unprocessed large subunit 1 and a small subunit gamma. It was originally believed to be a heterotrimer of an alpha (p30), a beta (p20) and a gamma subunit (p14). Interacts with Tbp. Taf4 interacts with TFIIA-L when TFIIA-L is in complex with Tbp.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P52654 | TfIIA-S P52656 | 3 | EBI-132413, EBI-123680 | |
BINARY | P52654 | TfIIA-S-2 Q9W5B9 | 5 | EBI-132413, EBI-181168 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 56-82 | Disordered | ||||
Sequence: LSPDSGDGSHPPPIVANNPKSHKAANA | ||||||
Region | 133-162 | Disordered | ||||
Sequence: EVNSQNPPPLHPTSAASMMQKQQQAASSGQ | ||||||
Region | 257-317 | Disordered | ||||
Sequence: QLDGALDSSDEDESEESDDNIDNDDDDDLDKDDDEDAEHEDAAEEEPLNSEDDVTDEDSAE | ||||||
Compositional bias | 264-317 | Acidic residues | ||||
Sequence: SSDEDESEESDDNIDNDDDDDLDKDDDEDAEHEDAAEEEPLNSEDDVTDEDSAE |
Sequence similarities
Belongs to the TFIIA subunit 1 family.
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
P52654-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameA
- Length366
- Mass (Da)39,268
- Last updated2005-07-19 v2
- Checksum73A3100332739643
P52654-2
- NameB
- Differences from canonical
- 75-77: Missing
P52654-3
- NameC
Features
Showing features for alternative sequence, sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_014784 | 1-39 | in isoform C | |||
Sequence: Missing | ||||||
Sequence conflict | 26 | in Ref. 1; AAB28821 | ||||
Sequence: A → G | ||||||
Alternative sequence | VSP_014785 | 75-77 | in isoform B and isoform C | |||
Sequence: Missing | ||||||
Sequence conflict | 147 | in Ref. 1; AAB28821 | ||||
Sequence: A → G | ||||||
Compositional bias | 264-317 | Acidic residues | ||||
Sequence: SSDEDESEESDDNIDNDDDDDLDKDDDEDAEHEDAAEEEPLNSEDDVTDEDSAE |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
S66759 EMBL· GenBank· DDBJ | AAB28821.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014297 EMBL· GenBank· DDBJ | AAF56687.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014297 EMBL· GenBank· DDBJ | AAN14105.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014297 EMBL· GenBank· DDBJ | AAN14106.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY061325 EMBL· GenBank· DDBJ | AAL28873.1 EMBL· GenBank· DDBJ | mRNA |