P52101 · GLRK_ECOLI
- ProteinSensor histidine kinase GlrK
- GeneglrK
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids475 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Member of the two-component regulatory system GlrR/GlrK that up-regulates transcription of the glmY sRNA when cells enter the stationary growth phase. Activates GlrR by phosphorylation.
Miscellaneous
Not required for the regulation of the glmY-glmZ-glmS regulatory cascade by glucosamine-6-phosphate depletion.
Catalytic activity
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | outer membrane-bounded periplasmic space | |
Cellular Component | plasma membrane | |
Molecular Function | ATP binding | |
Molecular Function | phosphorelay response regulator activity | |
Molecular Function | phosphorelay sensor kinase activity | |
Molecular Function | phosphotransferase activity, carboxyl group as acceptor | |
Molecular Function | protein histidine kinase activity | |
Molecular Function | protein kinase activator activity | |
Biological Process | intracellular chemical homeostasis | |
Biological Process | osmosensory signaling via phosphorelay pathway | |
Biological Process | response to epinephrine | |
Biological Process | signal transduction |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSensor histidine kinase GlrK
- EC number
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Escherichia
Accessions
- Primary accessionP52101
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cell inner membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-13 | Cytoplasmic | ||||
Sequence: MKRWPVFPRSLRQ | ||||||
Transmembrane | 14-34 | Helical | ||||
Sequence: LVMLAFLLILLPLLVLAWQAW | ||||||
Topological domain | 35-173 | Periplasmic | ||||
Sequence: QSLNALSDQAALVNRTTLIDARRSEAMTNAALEMERSYRQYCVLDDPTLAKVYQSQRKRYSEMLDAHAGVLPDDKLYQALRQDLHNLAQLQCNNSGPDAAAAARLEAFASANTEMVQATRTVVFSRGQQLQREIAERGQ | ||||||
Transmembrane | 174-194 | Helical | ||||
Sequence: YFGWQSLVLFLVSLVMVLLFT | ||||||
Topological domain | 195-475 | Cytoplasmic | ||||
Sequence: RMIIGPVKNIERMINRLGEGRSLGNSVSFSGPSELRSVGQRILWLSERLSWLESQRHQFLRHLSHELKTPLASMREGTELLADQVVGPLTPEQKEVVSILDSSSRNLQKLIEQLLDYNRKQADSAVELENVELAPLVETVVSAHSLPARAKMMHTDVDLKATACLAEPMLLMSVLDNLYSNAVHYGAESGNICLRSSLHGARVYIDVINTGTPIPQEERAMIFEPFFQGSHQRKGAVKGSGLGLSIARDCIRRMQGELYLVDESGQDVCFRIELPSSKNTK |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Mutants show decreased amounts of glmY.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000074915 | 1-475 | Sensor histidine kinase GlrK | |||
Sequence: MKRWPVFPRSLRQLVMLAFLLILLPLLVLAWQAWQSLNALSDQAALVNRTTLIDARRSEAMTNAALEMERSYRQYCVLDDPTLAKVYQSQRKRYSEMLDAHAGVLPDDKLYQALRQDLHNLAQLQCNNSGPDAAAAARLEAFASANTEMVQATRTVVFSRGQQLQREIAERGQYFGWQSLVLFLVSLVMVLLFTRMIIGPVKNIERMINRLGEGRSLGNSVSFSGPSELRSVGQRILWLSERLSWLESQRHQFLRHLSHELKTPLASMREGTELLADQVVGPLTPEQKEVVSILDSSSRNLQKLIEQLLDYNRKQADSAVELENVELAPLVETVVSAHSLPARAKMMHTDVDLKATACLAEPMLLMSVLDNLYSNAVHYGAESGNICLRSSLHGARVYIDVINTGTPIPQEERAMIFEPFFQGSHQRKGAVKGSGLGLSIARDCIRRMQGELYLVDESGQDVCFRIELPSSKNTK | ||||||
Modified residue | 259 | Phosphohistidine; by autocatalysis | ||||
Sequence: H |
Post-translational modification
Autophosphorylated.
Keywords
- PTM
Proteomic databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 256-472 | Histidine kinase | ||||
Sequence: HLSHELKTPLASMREGTELLADQVVGPLTPEQKEVVSILDSSSRNLQKLIEQLLDYNRKQADSAVELENVELAPLVETVVSAHSLPARAKMMHTDVDLKATACLAEPMLLMSVLDNLYSNAVHYGAESGNICLRSSLHGARVYIDVINTGTPIPQEERAMIFEPFFQGSHQRKGAVKGSGLGLSIARDCIRRMQGELYLVDESGQDVCFRIELPSSK |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length475
- Mass (Da)53,330
- Last updated2008-01-15 v3
- ChecksumEBB3F4D821C24AEB
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U36841 EMBL· GenBank· DDBJ | AAA79818.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
U00096 EMBL· GenBank· DDBJ | AAC75609.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP009048 EMBL· GenBank· DDBJ | BAE76732.1 EMBL· GenBank· DDBJ | Genomic DNA |