P51861 · CDR1_HUMAN
- ProteinCerebellar degeneration-related antigen 1
- GeneCDR1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids262 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
Miscellaneous
Autoantibodies against CDR1 are found in patients with paraneoplastic cerebellar degeneration.
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCerebellar degeneration-related antigen 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP51861
- Secondary accessions
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000089455 | 1-262 | Cerebellar degeneration-related antigen 1 | |||
Sequence: MAWLEDVDFLEDVPLLEDIPLLEDVPLLEDVPLLEDTSRLEDINLMEDMALLEDVDLLEDTDFLEDLDFSEAMDLREDKDFLEDMDSLEDMALLEDVDLLEDTDFLEDPDFLEAIDLREDKDFLEDMDSLEDLEAIGRCGFSGRHGFFGRRRFSGRPKLSGRLGLLGRRGFSGRLGGYWKTWIFWKTWIFWKTWIFRKTYIGWKTWIFSGRCGLTGRPGFGGRRRFFWKTLTDWKTWISFWKTLIDWKTWISFWKTLIDWKI |
Proteomic databases
PTM databases
Expression
Tissue specificity
Brain; predominantly expressed in normal neuroectodermal tissues and in certain malignant tumors.
Gene expression databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P51861 | ARFIP2 P53365 | 3 | EBI-2836538, EBI-638194 | |
BINARY | P51861 | CEP19 Q96LK0 | 3 | EBI-2836538, EBI-741885 | |
BINARY | P51861 | NDRG4 Q9ULP0-2 | 3 | EBI-2836538, EBI-11978907 | |
BINARY | P51861 | PTPN9 P43378 | 3 | EBI-2836538, EBI-742898 | |
BINARY | P51861 | ZMYND10 O75800 | 6 | EBI-2836538, EBI-747061 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for repeat, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 3-8 | 1 | ||||
Sequence: WLEDVD | ||||||
Region | 3-140 | 23 X 6 AA approximate repeats | ||||
Sequence: WLEDVDFLEDVPLLEDIPLLEDVPLLEDVPLLEDTSRLEDINLMEDMALLEDVDLLEDTDFLEDLDFSEAMDLREDKDFLEDMDSLEDMALLEDVDLLEDTDFLEDPDFLEAIDLREDKDFLEDMDSLEDLEAIGRCG | ||||||
Repeat | 9-14 | 2 | ||||
Sequence: FLEDVP | ||||||
Repeat | 15-20 | 3 | ||||
Sequence: LLEDIP | ||||||
Repeat | 21-26 | 4 | ||||
Sequence: LLEDVP | ||||||
Repeat | 27-32 | 5 | ||||
Sequence: LLEDVP | ||||||
Repeat | 33-38 | 6 | ||||
Sequence: LLEDTS | ||||||
Repeat | 39-44 | 7 | ||||
Sequence: RLEDIN | ||||||
Repeat | 45-50 | 8 | ||||
Sequence: LMEDMA | ||||||
Repeat | 51-56 | 9 | ||||
Sequence: LLEDVD | ||||||
Repeat | 57-62 | 10 | ||||
Sequence: LLEDTD | ||||||
Repeat | 63-68 | 11 | ||||
Sequence: FLEDLD | ||||||
Repeat | 69-74 | 12 | ||||
Sequence: FSEAMD | ||||||
Repeat | 75-80 | 13 | ||||
Sequence: LREDKD | ||||||
Repeat | 81-86 | 14 | ||||
Sequence: FLEDMD | ||||||
Repeat | 87-92 | 15 | ||||
Sequence: SLEDMA | ||||||
Repeat | 93-98 | 16 | ||||
Sequence: LLEDVD | ||||||
Repeat | 99-104 | 17 | ||||
Sequence: LLEDTD | ||||||
Repeat | 105-110 | 18 | ||||
Sequence: FLEDPD | ||||||
Repeat | 111-116 | 19 | ||||
Sequence: FLEAID | ||||||
Repeat | 117-122 | 20 | ||||
Sequence: LREDKD | ||||||
Repeat | 123-128 | 21 | ||||
Sequence: FLEDMD | ||||||
Repeat | 129-134 | 22 | ||||
Sequence: SLEDLE | ||||||
Repeat | 135-140 | 23 | ||||
Sequence: AIGRCG | ||||||
Repeat | 141-146 | 1 | ||||
Sequence: FSGRHG | ||||||
Region | 141-176 | 6 X 6 AA approximate repeats | ||||
Sequence: FSGRHGFFGRRRFSGRPKLSGRLGLLGRRGFSGRLG | ||||||
Repeat | 147-152 | 2 | ||||
Sequence: FFGRRR | ||||||
Repeat | 153-158 | 3 | ||||
Sequence: FSGRPK | ||||||
Repeat | 159-164 | 4 | ||||
Sequence: LSGRLG | ||||||
Repeat | 165-170 | 5 | ||||
Sequence: LLGRRG | ||||||
Repeat | 171-176 | 6 | ||||
Sequence: FSGRLG | ||||||
Repeat | 177-182 | 1 | ||||
Sequence: GYWKTW | ||||||
Region | 177-206 | 5 X 6 AA approximate repeats | ||||
Sequence: GYWKTWIFWKTWIFWKTWIFRKTYIGWKTW | ||||||
Repeat | 183-188 | 2 | ||||
Sequence: IFWKTW | ||||||
Repeat | 189-194 | 3 | ||||
Sequence: IFWKTW | ||||||
Repeat | 195-200 | 4 | ||||
Sequence: IFRKTY | ||||||
Repeat | 201-206 | 5 | ||||
Sequence: IGWKTW |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length262
- Mass (Da)31,279
- Last updated2007-10-23 v2
- Checksum08EB318075AEE356
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M31423 EMBL· GenBank· DDBJ | AAA51962.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
M16965 EMBL· GenBank· DDBJ | AAA52472.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
AL078639 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC113472 EMBL· GenBank· DDBJ | AAI13473.1 EMBL· GenBank· DDBJ | mRNA | ||
BC113474 EMBL· GenBank· DDBJ | AAI13475.1 EMBL· GenBank· DDBJ | mRNA |