P51815 · ZN75D_HUMAN
- ProteinZinc finger protein 75D
- GeneZNF75D
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids510 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Molecular Function | zinc ion binding | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
The subsequence KRIKHWKMASKLILPESLSLLTFEDVAVYFSEEEWQLLNPLEKTLYNDVMQDIYETVISLGLKLKNDTGNDHPISVSTSE, which contains the KRAB domain, shows transcriptional repressor activity in a high-throughput recruitment assay.
Names & Taxonomy
Protein names
- Recommended nameZinc finger protein 75D
- Alternative names
Gene names
- Community suggested namesZNF75D
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP51815
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 424 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000047384 | 1-510 | Zinc finger protein 75D | |||
Sequence: MAMRELNADSCSSPQMGAMWETSGSVKENSSQSKKYSTKIENLGPESACRHFWSFRYHEATGPLETISQLQKLCHQWLRPEIHSKEQILEMLVLEQFLSILPKETQNWVQKHHPQNVKQALVLVEFLQREPDGTKNEVTAHELGKEAVLLGGTAVAPGFKWKPAEPQPMGVFQKEYWNTYRVLQEQLGWNTHKETQPVYERAVHDQQMLALSEQKRIKHWKMASKLILPESLSLLTFEDVAVYFSEEEWQLLNPLEKTLYNDVMQDIYETVISLGLKLKNDTGNDHPISVSTSEIQTSGCEVSKKTRMKIAQKTMGRENPGDTHSVQKWHRAFPRKKRKKPATCKQELPKLMDLHGKGPTGEKPFKCQECGKSFRVSSDLIKHHRIHTGEKPYKCQQCDRRFRWSSDLNKHFMTHQGIKPYRCSWCGKSFSHNTNLHTHQRIHTGEKPFKCDECGKRFIQNSHLIKHQRTHTGEQPYTCSLCKRNFSRRSSLLRHQKLHRRREACLVSPN |
Proteomic databases
PTM databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-35 | Disordered | ||||
Sequence: MAMRELNADSCSSPQMGAMWETSGSVKENSSQSKK | ||||||
Compositional bias | 8-35 | Polar residues | ||||
Sequence: ADSCSSPQMGAMWETSGSVKENSSQSKK | ||||||
Domain | 49-131 | SCAN box | ||||
Sequence: CRHFWSFRYHEATGPLETISQLQKLCHQWLRPEIHSKEQILEMLVLEQFLSILPKETQNWVQKHHPQNVKQALVLVEFLQREP | ||||||
Domain | 235-318 | KRAB | ||||
Sequence: LTFEDVAVYFSEEEWQLLNPLEKTLYNDVMQDIYETVISLGLKLKNDTGNDHPISVSTSEIQTSGCEVSKKTRMKIAQKTMGRE | ||||||
Region | 313-343 | Disordered | ||||
Sequence: KTMGRENPGDTHSVQKWHRAFPRKKRKKPAT | ||||||
Zinc finger | 365-387 | C2H2-type 1 | ||||
Sequence: FKCQECGKSFRVSSDLIKHHRIH | ||||||
Zinc finger | 393-415 | C2H2-type 2 | ||||
Sequence: YKCQQCDRRFRWSSDLNKHFMTH | ||||||
Zinc finger | 421-443 | C2H2-type 3 | ||||
Sequence: YRCSWCGKSFSHNTNLHTHQRIH | ||||||
Zinc finger | 449-471 | C2H2-type 4 | ||||
Sequence: FKCDECGKRFIQNSHLIKHQRTH | ||||||
Zinc finger | 477-499 | C2H2-type 5 | ||||
Sequence: YTCSLCKRNFSRRSSLLRHQKLH |
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P51815-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length510
- Mass (Da)59,298
- Last updated2008-11-04 v2
- Checksum37D405F102965A24
P51815-2
- Name2
- Differences from canonical
- 138-232: Missing
Features
Showing features for compositional bias, alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 8-35 | Polar residues | ||||
Sequence: ADSCSSPQMGAMWETSGSVKENSSQSKK | ||||||
Alternative sequence | VSP_044460 | 138-232 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 409 | in Ref. 1; BAG52399 | ||||
Sequence: N → S |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK091687 EMBL· GenBank· DDBJ | BAG52399.1 EMBL· GenBank· DDBJ | mRNA | ||
AK290215 EMBL· GenBank· DDBJ | BAF82904.1 EMBL· GenBank· DDBJ | mRNA | ||
AL832801 EMBL· GenBank· DDBJ | CAI46130.1 EMBL· GenBank· DDBJ | mRNA | ||
AL450472 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL590282 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC109100 EMBL· GenBank· DDBJ | AAI09101.1 EMBL· GenBank· DDBJ | mRNA | ||
S67970 EMBL· GenBank· DDBJ | AAB29696.1 EMBL· GenBank· DDBJ | mRNA | ||
S43109 EMBL· GenBank· DDBJ | AAB22971.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X68010 EMBL· GenBank· DDBJ | CAA48147.1 EMBL· GenBank· DDBJ | Genomic DNA |