P50945 · MIC27_YEAST
- ProteinMICOS complex subunit MIC27
- GeneMIC27
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids234 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | MICOS complex | |
Cellular Component | mitochondrial crista junction | |
Cellular Component | mitochondrial inner membrane | |
Cellular Component | mitochondrion | |
Biological Process | cristae formation | |
Biological Process | protein-containing complex organization |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameMICOS complex subunit MIC27
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP50945
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Multi-pass membrane protein
Note: Enriched at crista junctions.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-100 | Mitochondrial intermembrane | ||||
Sequence: MVNFYDDVDESKSHGEFPLIPVVLQNSSELSVRTIPTGNEIIESVHLTKWLRKYRNALASQLDRYEKGWQSKIANFRLQVQHVINYSRKNIFNVDSENKH | ||||||
Transmembrane | 101-120 | Helical | ||||
Sequence: TVVPGSLIALGAFFAGSIAV | ||||||
Topological domain | 121-141 | Mitochondrial matrix | ||||
Sequence: NRSNWGAKRLIFGHKSSILEK | ||||||
Transmembrane | 142-161 | Helical | ||||
Sequence: LCTSLPSRILLPWVLAAATF | ||||||
Topological domain | 162-234 | Mitochondrial intermembrane | ||||
Sequence: KYWAPQTSQNLVNATENDLLPADFVKSYHNTWKRIYEEGYVAKKCDLKRQIDQTLQKNIRYAREQLYEKLEQA |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Increases frequency of mitochondrial genome loss. Partially altered shape of the mitochondrial network with condensed, fragmented mitochondria accumulating at the periphery of cells. 20-40% of mitochondria exhibit an increased inner membrane surface and stacks of lamellar cristae disconnected from the inner boundary membrane.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 3 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000203438 | 1-234 | MICOS complex subunit MIC27 | |||
Sequence: MVNFYDDVDESKSHGEFPLIPVVLQNSSELSVRTIPTGNEIIESVHLTKWLRKYRNALASQLDRYEKGWQSKIANFRLQVQHVINYSRKNIFNVDSENKHTVVPGSLIALGAFFAGSIAVNRSNWGAKRLIFGHKSSILEKLCTSLPSRILLPWVLAAATFKYWAPQTSQNLVNATENDLLPADFVKSYHNTWKRIYEEGYVAKKCDLKRQIDQTLQKNIRYAREQLYEKLEQA |
Proteomic databases
Interaction
Subunit
Component of the mitochondrial contact site and cristae organizing system (MICOS) complex, composed of at least MIC10, MIC12, MIC19, MIC26, MIC27 and MIC60. This complex was also known under the names MINOS or MitOS complex.
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Sequence similarities
Belongs to the apolipoprotein O/MICOS complex subunit Mic27 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length234
- Mass (Da)26,960
- Last updated1996-10-01 v1
- Checksum8DFD8FD42E71B8DB
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DQ115393 EMBL· GenBank· DDBJ | AAZ22507.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z50161 EMBL· GenBank· DDBJ | CAA90526.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z71376 EMBL· GenBank· DDBJ | CAA95976.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY692704 EMBL· GenBank· DDBJ | AAT92723.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006947 EMBL· GenBank· DDBJ | DAA10445.1 EMBL· GenBank· DDBJ | Genomic DNA |