P50875 · SPT20_YEAST
- ProteinTranscription factor SPT20
- GeneSPT20
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids604 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription regulator. May recruit TATA binding protein (TBP) and possibly other basal factors to bind to the TATA box. Functions as a component of the transcription regulatory histone acetylation (HAT) complexes SAGA, SALSA and SLIK. SAGA is involved in RNA polymerase II-dependent transcriptional regulation of approximately 10% of yeast genes. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction (SPT3, SPT8 and SPT20) and promoter selectivity, interaction with transcription activators (GCN5, ADA2, ADA3 and TRA1), and chromatin modification through histone acetylation (GCN5) and deubiquitination (UBP8). SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). SALSA, an altered form of SAGA, may be involved in positive transcriptional regulation. SLIK is proposed to have partly overlapping functions with SAGA. It preferentially acetylates methylated histone H3, at least after activation at the GAL1-10 locus.
Miscellaneous
Present with 4150 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Cellular Component | SAGA complex | |
Cellular Component | SLIK (SAGA-like) complex | |
Molecular Function | transcription coregulator activity | |
Biological Process | chromatin organization | |
Biological Process | IRE1-mediated unfolded protein response | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTranscription factor SPT20
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP50875
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000072161 | 1-604 | Transcription factor SPT20 | |||
Sequence: MSANSPTGNDPHVFGIPVNATPSNMGSPGSPVNVPPPMNPAVANVNHPVMRTNSNSNANEGTRTLTREQIQQLQQRQRLLLQQRLLEQQRKQQALQNYEAQFYQMLMTLNKRPKRLYNFVEDADSILKKYEQYLHSFEFHIYENNYKICAPANSRLQQQQKQPELTSDGLILTKNNETLKEFLEYVARGRIPDAIMEVLRDCNIQFYEGNLILQVYDHTNTVDVTPKENKPNLNSSSSPSNNNSTQDNSKIQQPSEPNSGVANTGANTANKKASFKRPRVYRTLLKPNDLTTYYDMMSYADNARFSDSIYQQFESEILTLTKRNLSLSVPLNPYEHRDMLEETAFSEPHWDSEKKSFIHEHRAESTREGTKGVVGHIEERDEFPQHSSNYEQLMLIMNERTTTITNSTFAVSLTKNAMEIASSSSNGVRGASSSTSNSASNTRNNSLANGNQVALAAAAAAAAVGSTMGNDNNQFSRLKFIEQWRINKEKRKQQALSANINPTPFNARISMTAPLTPQQQLLQRQQQALEQQQNGGAMKNANKRSGNNATSNNNNNNNNLDKPKVKRPRKNAKKSESGTPAPKKKRMTKKKQSASSTPSSTTMS | ||||||
Modified residue | 446 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 516 | Phosphothreonine | ||||
Sequence: T |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Component of the 1.8 MDa SAGA complex, which consists of at least of TRA1, CHD1, SPT7, TAF5, ADA3, SGF73, SPT20/ADA5, SPT8, TAF12, TAF6, HFI1/ADA1, UBP8, GCN5, ADA2, SPT3, SGF29, TAF10, TAF9, SGF11 and SUS1. TAF5, TAF6, TAF9, TAF19, TAF12 and ADA1 seem to be present in 2 copies. SAGA is built of 5 distinct domains with specialized functions. Domain I (containing TRA1) probably represents the activator interaction surface. Domain II (containing TAF5 and TAF6, and probably TAF9 and TAF10), domain III (containing GCN5, TAF10, SPT7, TAF5 and ADA1, and probably ADA2, ADA3 and TAF12), and domain IV (containing HFI1/ADA1 and TAF6, and probably TAF9) are believed to play primarily an architectural role. Domain III also harbors the HAT activity. Domain V (containing SPT3 and SPT20, and probably SPT8) represents the TBP-interacting module, which may be associated transiently with SAGA. SUS1 associates with the SAC3-THP1 complex. Component of the SALSA complex, which consists of at least TRA1, SPT7 (C-terminal truncated form), TAF5, ADA3, SPT20, TAF12, TAF6, HFI1, GCN5, ADA2 and SPT3. Component of the SLIK complex, which consists of at least TRA1, CHD1, SPT7, TAF5, ADA3, SPT20, RTG2, TAF12, TAF6, HFI1, UBP8, GCN5, ADA2, SPT3, SGF29, TAF10 and TAF9. Component of the ADA/GCN5 complex that consists of HFI1/ADA1, ADA2, ADA3, SPT20/ADA5 and GCN5 and is probably a subcomplex of SAGA.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P50875 | HFI1 Q12060 | 14 | EBI-17751, EBI-8287 | |
BINARY | P50875 | SGF73 P53165 | 8 | EBI-17751, EBI-23812 | |
BINARY | P50875 | SPT3 P06844 | 10 | EBI-17751, EBI-17921 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-33 | Disordered | ||||
Sequence: MSANSPTGNDPHVFGIPVNATPSNMGSPGSPVN | ||||||
Compositional bias | 223-271 | Polar residues | ||||
Sequence: DVTPKENKPNLNSSSSPSNNNSTQDNSKIQQPSEPNSGVANTGANTANK | ||||||
Region | 223-273 | Disordered | ||||
Sequence: DVTPKENKPNLNSSSSPSNNNSTQDNSKIQQPSEPNSGVANTGANTANKKA | ||||||
Region | 422-446 | Disordered | ||||
Sequence: SSSSNGVRGASSSTSNSASNTRNNS | ||||||
Compositional bias | 519-561 | Polar residues | ||||
Sequence: QQLLQRQQQALEQQQNGGAMKNANKRSGNNATSNNNNNNNNLD | ||||||
Region | 519-604 | Disordered | ||||
Sequence: QQLLQRQQQALEQQQNGGAMKNANKRSGNNATSNNNNNNNNLDKPKVKRPRKNAKKSESGTPAPKKKRMTKKKQSASSTPSSTTMS |
Sequence similarities
Belongs to the SPT20 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length604
- Mass (Da)67,796
- Last updated1996-10-01 v1
- Checksum3D67937B65F9AA6A
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 223-271 | Polar residues | ||||
Sequence: DVTPKENKPNLNSSSSPSNNNSTQDNSKIQQPSEPNSGVANTGANTANK | ||||||
Sequence conflict | 293 | in Ref. 5; CAA88279 | ||||
Sequence: Y → S | ||||||
Compositional bias | 519-561 | Polar residues | ||||
Sequence: QQLLQRQQQALEQQQNGGAMKNANKRSGNNATSNNNNNNNNLD |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U43153 EMBL· GenBank· DDBJ | AAB07899.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U22063 EMBL· GenBank· DDBJ | AAB07900.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z74890 EMBL· GenBank· DDBJ | CAA99169.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z48239 EMBL· GenBank· DDBJ | CAA88279.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006948 EMBL· GenBank· DDBJ | DAA10637.1 EMBL· GenBank· DDBJ | Genomic DNA |