P50540 · MXI1_MOUSE
- ProteinMax-interacting protein 1
- GeneMxi1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids228 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Transcriptional repressor. MXI1 binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. MXI1 thus antagonizes MYC transcriptional activity by competing for MAX. Isoform Short, which lacks a segment, has a much stronger suppressive potential and associates with a SIN3 homologous protein.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | protein dimerization activity | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Biological Process | blastocyst formation | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameMax-interacting protein 1
- Short namesMax interactor 1
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP50540
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000127286 | 1-228 | Max-interacting protein 1 | |||
Sequence: MERVRMINVQRLLEAAEFLERRERECEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKLEEAERKSQHQLENLEREQRFLKRRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFSHGEADSVSTTSISDLDDHSSLQSVGSDEGYSSASVKLSFAS |
Proteomic databases
PTM databases
Expression
Developmental stage
Primarily expressed in differentiating cells. Also expressed in the proliferating cells of the developing CNS and the epidermis. In the spinal cord at embryonic day 10.5, expressed in the ventricular zone of the neural tube. Expressed at highest levels in cells accumulating in the intermediate zone. At 11.5 and 12.5 dpc, highly expressed in the intermediate zone and at reduced levels in the ventricular zone that mostly persists in the dorsal part of the neural tube. At 14.5 dpc, expressed throughout the spinal cord. In the developing epidermis at 14.5 dpc, found in the dorsal lateral epidermis. At 17 dpc, expression is restricted not only to the differentiating cells of the epidermis but also to the proliferating cell compartment and expression extends into the first differentiating cell layers, but decreases in the uppermost layers of the epidermis.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 30-76 | Disordered | ||||
Sequence: YASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRSTHNELE | ||||||
Compositional bias | 54-71 | Polar residues | ||||
Sequence: AQKHSSGSSNTSTANRST | ||||||
Domain | 67-119 | bHLH | ||||
Sequence: ANRSTHNELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKL | ||||||
Region | 160-228 | Disordered | ||||
Sequence: SIGSTISSDRSDSEREEIEVDVESTEFSHGEADSVSTTSISDLDDHSSLQSVGSDEGYSSASVKLSFAS | ||||||
Compositional bias | 168-187 | Basic and acidic residues | ||||
Sequence: DRSDSEREEIEVDVESTEFS | ||||||
Compositional bias | 188-228 | Polar residues | ||||
Sequence: HGEADSVSTTSISDLDDHSSLQSVGSDEGYSSASVKLSFAS |
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P50540-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameLong
- Length228
- Mass (Da)25,978
- Last updated1996-10-01 v1
- Checksum7B5D4ACAEF97C4F1
P50540-2
- NameShort
- Differences from canonical
- 1-36: Missing
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q3U3X2 | Q3U3X2_MOUSE | Mxi1 | 295 | ||
A0A494B9I5 | A0A494B9I5_MOUSE | Mxi1 | 84 | ||
A0A494B9V1 | A0A494B9V1_MOUSE | Mxi1 | 182 |
Features
Showing features for sequence conflict, alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 1-25 | in Ref. 3 | ||||
Sequence: MERVRMINVQRLLEAAEFLERRERE → MEKHINTFLQNVQILLEAASYLEQIEKENKK | ||||||
Alternative sequence | VSP_002141 | 1-36 | in isoform Short | |||
Sequence: Missing | ||||||
Compositional bias | 54-71 | Polar residues | ||||
Sequence: AQKHSSGSSNTSTANRST | ||||||
Compositional bias | 168-187 | Basic and acidic residues | ||||
Sequence: DRSDSEREEIEVDVESTEFS | ||||||
Compositional bias | 188-228 | Polar residues | ||||
Sequence: HGEADSVSTTSISDLDDHSSLQSVGSDEGYSSASVKLSFAS |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L38822 EMBL· GenBank· DDBJ | AAA65684.1 EMBL· GenBank· DDBJ | mRNA | ||
L38821 EMBL· GenBank· DDBJ | AAA65685.1 EMBL· GenBank· DDBJ | mRNA | ||
U24674 EMBL· GenBank· DDBJ | AAA65183.1 EMBL· GenBank· DDBJ | mRNA | ||
U24673 EMBL· GenBank· DDBJ | AAA65182.1 EMBL· GenBank· DDBJ | mRNA | ||
D31824 EMBL· GenBank· DDBJ | BAA06612.1 EMBL· GenBank· DDBJ | mRNA |