P50458 · LHX2_HUMAN
- ProteinLIM/homeobox protein Lhx2
- GeneLHX2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids406 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Acts as a transcriptional activator. Stimulates the promoter of the alpha-glycoprotein gene. Transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types (By similarity).
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 266-325 | Homeobox | ||||
Sequence: TKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNL |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameLIM/homeobox protein Lhx2
- Short namesHomeobox protein LH-2; LIM homeobox protein 2
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP50458
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 391 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000075778 | 1-406 | UniProt | LIM/homeobox protein Lhx2 | |||
Sequence: MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQGEYPAHFNHADVAAAAAAAAAAKSAGLGAAGANPLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAYNAALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKSTDAALQTGTPSGPASELSNASLSPSSTPTTLTDLTSPTLPTVTSVLTSVPGNLEGHEPHSPSQTTLTNLF | |||||||
Modified residue (large scale data) | 230 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 245 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts (via LIM domains) with CITED2. Interacts with POU4F2.
Binary interactions
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, motif, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 53-105 | LIM zinc-binding 1 | ||||
Sequence: CAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKED | ||||||
Domain | 115-168 | LIM zinc-binding 2 | ||||
Sequence: CARCHLGISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLH | ||||||
Region | 250-270 | Disordered | ||||
Sequence: DAEHLDRDQPYPSSQKTKRMR | ||||||
Motif | 307-323 | Nuclear localization signal | ||||
Sequence: KRVLQVWFQNARAKFRR | ||||||
Region | 328-374 | Disordered | ||||
Sequence: QENTGVDKSTDAALQTGTPSGPASELSNASLSPSSTPTTLTDLTSPT | ||||||
Compositional bias | 330-374 | Polar residues | ||||
Sequence: NTGVDKSTDAALQTGTPSGPASELSNASLSPSSTPTTLTDLTSPT | ||||||
Region | 387-406 | Disordered | ||||
Sequence: GNLEGHEPHSPSQTTLTNLF |
Domain
LIM domains are necessary for transcription activation.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length406
- Mass (Da)44,373
- Last updated2000-05-30 v2
- ChecksumDF73AAC81867D30D
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 22-28 | in Ref. 1; AAB08752 | ||||
Sequence: AKSEAPA → QERGSR | ||||||
Sequence conflict | 54 | in Ref. 1; AAB08752 | ||||
Sequence: A → G | ||||||
Sequence conflict | 107 | in Ref. 3 | ||||
Sequence: Y → YSPSLHGPY | ||||||
Sequence conflict | 187 | in Ref. 1 | ||||
Sequence: A → Q | ||||||
Sequence conflict | 190-192 | in Ref. 1 | ||||
Sequence: AAA → RAR | ||||||
Sequence conflict | 196 | in Ref. 1 | ||||
Sequence: Missing | ||||||
Sequence conflict | 241-242 | in Ref. 1; AAB08752 | ||||
Sequence: NA → TR | ||||||
Compositional bias | 330-374 | Polar residues | ||||
Sequence: NTGVDKSTDAALQTGTPSGPASELSNASLSPSSTPTTLTDLTSPT | ||||||
Sequence conflict | 391-406 | in Ref. 1; AAB08752 | ||||
Sequence: GHEPHSPSQTTLTNLF → AMSLTAPHKRLLPTFSNDSQPPHPTISLKKKLSLV |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U11701 EMBL· GenBank· DDBJ | AAB08752.1 EMBL· GenBank· DDBJ | mRNA | ||
BC093662 EMBL· GenBank· DDBJ | AAH93662.1 EMBL· GenBank· DDBJ | mRNA | ||
BC112185 EMBL· GenBank· DDBJ | AAI12186.1 EMBL· GenBank· DDBJ | mRNA | ||
AK094511 EMBL· GenBank· DDBJ | BAC04371.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AF124735 EMBL· GenBank· DDBJ | AAD20013.1 EMBL· GenBank· DDBJ | mRNA |