P49905 · TAF12_DROME
- ProteinTranscription initiation factor TFIID subunit 12
- GeneTaf12
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids196 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Cellular Component | SAGA complex | |
Cellular Component | transcription factor TFIID complex | |
Molecular Function | DNA binding | |
Molecular Function | protein heterodimerization activity | |
Molecular Function | TBP-class protein binding | |
Biological Process | RNA polymerase II preinitiation complex assembly | |
Biological Process | transcription initiation at RNA polymerase II promoter |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTranscription initiation factor TFIID subunit 12
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionP49905
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000033584 | 1-196 | Transcription initiation factor TFIID subunit 12 | |||
Sequence: MSDLFTTFDSNGVAEHHLHHNHNSTSSASGLLHDPPMASPSQHSPMTNNSNSSSQNGGPVSGLGTGTGPISGGSKSSNHTSSAAGSENTPMLTKPRLTELVREVDTTTQLDEDVEELLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDVQLHFERKYNMWIPGFGTDELRPYKRAAVTEAHKQRLALIRKTIKKY |
Proteomic databases
Expression
Gene expression databases
Interaction
Subunit
Belongs to the TFIID complex which is composed of TATA binding protein (Tbp) and a number of TBP-associated factors (TAFs). Interacts with Tbp, Taf2 and Taf4.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 17-97 | Disordered | ||||
Sequence: HLHHNHNSTSSASGLLHDPPMASPSQHSPMTNNSNSSSQNGGPVSGLGTGTGPISGGSKSSNHTSSAAGSENTPMLTKPRL | ||||||
Compositional bias | 40-93 | Polar residues | ||||
Sequence: PSQHSPMTNNSNSSSQNGGPVSGLGTGTGPISGGSKSSNHTSSAAGSENTPMLT | ||||||
Domain | 93-160 | Histone-fold | ||||
Sequence: TKPRLTELVREVDTTTQLDEDVEELLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDVQLHFERKYNM |
Sequence similarities
Belongs to the TAF12 family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative initiation.
P49905-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name28 kDa
- SynonymsA, B
- Length196
- Mass (Da)21,523
- Last updated1996-10-01 v1
- Checksum9D6AE98FB9AEC1EC
P49905-2
- Name22 kDa
- SynonymsD
- Differences from canonical
- 1-36: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0B4KFN0 | A0A0B4KFN0_DROME | Taf12 | 160 |
Features
Showing features for alternative sequence, sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_018890 | 1-36 | in isoform 22 kDa | |||
Sequence: Missing | ||||||
Sequence conflict | 15 | in Ref. 2; AAB29540 | ||||
Sequence: E → R | ||||||
Compositional bias | 40-93 | Polar residues | ||||
Sequence: PSQHSPMTNNSNSSSQNGGPVSGLGTGTGPISGGSKSSNHTSSAAGSENTPMLT | ||||||
Sequence conflict | 127 | in Ref. 2; AAB29540 | ||||
Sequence: E → R |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U06450 EMBL· GenBank· DDBJ | AAC46479.1 EMBL· GenBank· DDBJ | mRNA | ||
U06456 EMBL· GenBank· DDBJ | AAB19244.1 EMBL· GenBank· DDBJ | mRNA | ||
S67741 EMBL· GenBank· DDBJ | AAB29540.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014297 EMBL· GenBank· DDBJ | AAF54677.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014297 EMBL· GenBank· DDBJ | AAF54678.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014297 EMBL· GenBank· DDBJ | AAF54679.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY061435 EMBL· GenBank· DDBJ | AAL28983.1 EMBL· GenBank· DDBJ | mRNA |