P49716 · CEBPD_HUMAN
- ProteinCCAAT/enhancer-binding protein delta
- GeneCEBPD
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids269 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers (PubMed:16397300).
Important transcription factor regulating the expression of genes involved in immune and inflammatory responses (PubMed:16397300, PubMed:1741402).
Transcriptional activator that enhances IL6 transcription alone and as heterodimer with CEBPB (PubMed:1741402).
Important transcription factor regulating the expression of genes involved in immune and inflammatory responses (PubMed:16397300, PubMed:1741402).
Transcriptional activator that enhances IL6 transcription alone and as heterodimer with CEBPB (PubMed:1741402).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
The subsequence AREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPS, which contains the bZIP_2 domain, shows transcriptional repressor activity in a high-throughput recruitment assay.
Names & Taxonomy
Protein names
- Recommended nameCCAAT/enhancer-binding protein delta
- Short namesC/EBP delta
- Alternative names
Gene names
- Community suggested namesCEBPD
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP49716
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for mutagenesis, natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 120 | Loss of sumoylation. | ||||
Sequence: K → A | ||||||
Natural variant | VAR_037087 | 248 | in dbSNP:rs34948549 | |||
Sequence: R → W |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 336 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain, cross-link, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Initiator methionine | 1 | UniProt | Removed | ||||
Sequence: M | |||||||
Modified residue | 2 | UniProt | N-acetylserine | ||||
Sequence: S | |||||||
Chain | PRO_0000076621 | 2-269 | UniProt | CCAAT/enhancer-binding protein delta | |||
Sequence: SAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR | |||||||
Cross-link | 120 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 191 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 256 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Binds DNA as a homodimer and as a heterodimer (PubMed:1741402).
Can form stable heterodimers with CEBPB (PubMed:1741402).
Can form stable heterodimers with CEBPA and CEBPE. Directly interacts with SPI1/PU.1; this interaction does not affect DNA-binding properties of each partner. Interacts with PRDM16
Can form stable heterodimers with CEBPB (PubMed:1741402).
Can form stable heterodimers with CEBPA and CEBPE. Directly interacts with SPI1/PU.1; this interaction does not affect DNA-binding properties of each partner. Interacts with PRDM16
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P49716 | ATF4 P18848 | 2 | EBI-7962058, EBI-492498 | |
BINARY | P49716 | CEBPA P49715 | 2 | EBI-7962058, EBI-1172054 | |
BINARY | P49716 | CEBPG P53567 | 2 | EBI-7962058, EBI-740209 | |
BINARY | P49716 | DDIT3 P35638 | 2 | EBI-7962058, EBI-742651 | |
BINARY | P49716 | FANCD2 Q9BXW9 | 8 | EBI-7962058, EBI-359343 | |
BINARY | P49716 | IPO4 Q8TEX9 | 5 | EBI-7962058, EBI-395967 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-48 | Disordered | ||||
Sequence: MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAA | ||||||
Region | 97-133 | Disordered | ||||
Sequence: PLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGS | ||||||
Region | 151-219 | Disordered | ||||
Sequence: AAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEM | ||||||
Compositional bias | 156-171 | Pro residues | ||||
Sequence: TPPTSPEPPRSSPRQT | ||||||
Compositional bias | 181-219 | Basic and acidic residues | ||||
Sequence: SAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEM | ||||||
Domain | 191-254 | bZIP | ||||
Sequence: SPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQL | ||||||
Region | 195-222 | Basic motif | ||||
Sequence: RQRRERNNIAVRKSRDKAKRRNQEMQQK | ||||||
Region | 226-254 | Leucine-zipper | ||||
Sequence: LSAENEKLHQRVEQLTRDLAGLRQFFKQL |
Sequence similarities
Belongs to the bZIP family. C/EBP subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length269
- Mass (Da)28,467
- Last updated2007-11-13 v2
- ChecksumAFDE9E2244BDF84A
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 2 | in Ref. 1; AAA59927 | ||||
Sequence: S → T | ||||||
Sequence conflict | 13 | in Ref. 1; AAA59927 | ||||
Sequence: R → G | ||||||
Sequence conflict | 140-141 | in Ref. 1; AAA59927 and 2; AAB27293 | ||||
Sequence: AA → GP | ||||||
Compositional bias | 156-171 | Pro residues | ||||
Sequence: TPPTSPEPPRSSPRQT | ||||||
Compositional bias | 181-219 | Basic and acidic residues | ||||
Sequence: SAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEM |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M83667 EMBL· GenBank· DDBJ | AAA59927.1 EMBL· GenBank· DDBJ | mRNA | ||
S63168 EMBL· GenBank· DDBJ | AAB27293.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471068 EMBL· GenBank· DDBJ | EAW86679.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC105109 EMBL· GenBank· DDBJ | AAI05110.1 EMBL· GenBank· DDBJ | mRNA |