P49029 · MGN_CAEEL
- ProteinProtein mago nashi homolog
- Genemag-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids152 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs (Probable). Positively regulates the nuclear export of spliced mRNAs including the sex determination gene tra-2 (PubMed:23149939).
Promotes oogenesis and represses germline masculinization and spermatogenesis (PubMed:10656761, PubMed:14706697, PubMed:23149939).
Required for embryonic development, possibly through positively regulating the expression of pie-1 (PubMed:30279189).
Not required for the spatial patterning of pie-1 in embryos (PubMed:30279189).
Promotes oogenesis and represses germline masculinization and spermatogenesis (PubMed:10656761, PubMed:14706697, PubMed:23149939).
Required for embryonic development, possibly through positively regulating the expression of pie-1 (PubMed:30279189).
Not required for the spatial patterning of pie-1 in embryos (PubMed:30279189).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | catalytic step 2 spliceosome | |
Cellular Component | exon-exon junction complex | |
Biological Process | feminization of hermaphroditic germ-line | |
Biological Process | mRNA processing | |
Biological Process | mRNA transport | |
Biological Process | nuclear mRNA surveillance | |
Biological Process | oogenesis | |
Biological Process | positive regulation of egg-laying behavior | |
Biological Process | positive regulation of oogenesis | |
Biological Process | RNA splicing |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein mago nashi homolog
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionP49029
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown results in embryonic lethality due to developmental arrest during morphogenesis (PubMed:30279189).
RNAi-mediated knockdown in the syncytial gonads of adult hermaphrodites results in some inviable embryos and then eventually no egg laying (PubMed:10656761).
RNAi-mediated knockdown at the L1 larval stage results in the accumulation of unspliced mRNAs including ama-1 and ife-4 in the cytoplasm, and specifically in the production of an irregular unspliced form of the sex determining protein tra-2, which accumulates in the cytoplasm and inhibits the regular tra-2 isoforms a and c reducing their expression and disrupting their nuclear localization (PubMed:23149939).
RNAi-mediated knockdown in L4 hermaphrodite larvae, results in no viable embryos and egg laying ceases due to masculinization of the germline (also called a mog phenotype) with animals producing undifferentiated germ cells and sperm instead of oocytes (PubMed:10656761, PubMed:14706697).
In these animals, sperm are distributed throughout the germline, including the distal tip region (PubMed:10656761).
RNAi-mediated knockdown does not result in masculinization of the germline in some animals, but these animals still do not produce oocytes with germlines appearing disorganized (PubMed:10656761).
RNAi-mediated knockdown reduces the expression of pie-1 in P2 blastomeres (PubMed:30279189).
RNAi-mediated knockdown in the syncytial gonads of adult hermaphrodites results in some inviable embryos and then eventually no egg laying (PubMed:10656761).
RNAi-mediated knockdown at the L1 larval stage results in the accumulation of unspliced mRNAs including ama-1 and ife-4 in the cytoplasm, and specifically in the production of an irregular unspliced form of the sex determining protein tra-2, which accumulates in the cytoplasm and inhibits the regular tra-2 isoforms a and c reducing their expression and disrupting their nuclear localization (PubMed:23149939).
RNAi-mediated knockdown in L4 hermaphrodite larvae, results in no viable embryos and egg laying ceases due to masculinization of the germline (also called a mog phenotype) with animals producing undifferentiated germ cells and sperm instead of oocytes (PubMed:10656761, PubMed:14706697).
In these animals, sperm are distributed throughout the germline, including the distal tip region (PubMed:10656761).
RNAi-mediated knockdown does not result in masculinization of the germline in some animals, but these animals still do not produce oocytes with germlines appearing disorganized (PubMed:10656761).
RNAi-mediated knockdown reduces the expression of pie-1 in P2 blastomeres (PubMed:30279189).
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000174151 | 1-152 | Protein mago nashi homolog | |||
Sequence: MSGEEEKAADFYVRYYVGHKGKFGHEFLEFEFRPNGSLRYANNSNYKNDTMIRKEATVSESVLSELKRIIEDSEIMQEDDDNWPEPDKIGRQELEILYKNEHISFTTGKIGALADVNNSKDPDGLRSFYYLVQDLKCLVFSLIGLHFKIKPI |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the soma and germline of hermaphrodites.
Developmental stage
Expressed at all stages of development in hermaphrodites (PubMed:10656761).
More abundant in embryos than in larvae and adults (PubMed:10656761).
First expressed in embryos prior to morphogenesis, and after morphogenesis begins, primarily expressed in the head and tail regions (PubMed:10656761).
More abundant in embryos than in larvae and adults (PubMed:10656761).
First expressed in embryos prior to morphogenesis, and after morphogenesis begins, primarily expressed in the head and tail regions (PubMed:10656761).
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Length152
- Mass (Da)17,637
- Last updated1999-07-15 v2
- ChecksumEBA9B49487385E01
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 41 | in Ref. 3; AAB66721 | ||||
Sequence: A → G |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KF051002 EMBL· GenBank· DDBJ | AHX83788.1 EMBL· GenBank· DDBJ | mRNA | ||
BX284601 EMBL· GenBank· DDBJ | CAB03239.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF007861 EMBL· GenBank· DDBJ | AAB66721.1 EMBL· GenBank· DDBJ | mRNA |