P48810 · RB87F_DROME
- ProteinHeterogeneous nuclear ribonucleoprotein 87F
- GeneHrb87F
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids385 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
This protein is a component of ribonucleosomes. Could be needed to organize a concentration gradient of a dorsalizing morphogen (Dm) originating in the germinal vesicle.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromatin | |
Cellular Component | cytoplasm | |
Cellular Component | heterochromatin | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | omega speckle | |
Cellular Component | polytene chromosome puff | |
Cellular Component | ribonucleoprotein complex | |
Molecular Function | mRNA 3'-UTR binding | |
Molecular Function | mRNA binding | |
Molecular Function | poly(G) binding | |
Molecular Function | sequence-specific DNA binding | |
Biological Process | compound eye morphogenesis | |
Biological Process | female gonad development | |
Biological Process | mitotic cell cycle | |
Biological Process | positive regulation of mRNA splicing, via spliceosome | |
Biological Process | regulation of alternative mRNA splicing, via spliceosome | |
Biological Process | response to heat | |
Biological Process | response to starvation |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameHeterogeneous nuclear ribonucleoprotein 87F
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionP48810
- Secondary accessions
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000081750 | 1-385 | Heterogeneous nuclear ribonucleoprotein 87F | |||
Sequence: MAEQNDSNGNYDDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMDRQGGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGGGPQRNSNFGNNRPAPYSQGGGGGGFNKGNQGGGQGFAGNNYNTGGGGQGGNMGGGNRRY |
Proteomic databases
Expression
Developmental stage
Expressed both maternally and zygotically.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 24-101 | RRM 1 | ||||
Sequence: RKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVP | ||||||
Domain | 115-192 | RRM 2 | ||||
Sequence: KKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIA | ||||||
Region | 192-289 | Disordered | ||||
Sequence: AKQDMDRQGGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGG | ||||||
Compositional bias | 260-284 | Polar residues | ||||
Sequence: GGSGGWNQQGGSGGGPWNNQGGGNG | ||||||
Region | 305-385 | Disordered | ||||
Sequence: GNGGGGGGGGGFGNEYQQSYGGGPQRNSNFGNNRPAPYSQGGGGGGFNKGNQGGGQGFAGNNYNTGGGGQGGNMGGGNRRY | ||||||
Compositional bias | 322-340 | Polar residues | ||||
Sequence: QSYGGGPQRNSNFGNNRPA | ||||||
Compositional bias | 358-375 | Polar residues | ||||
Sequence: GGQGFAGNNYNTGGGGQG |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P48810-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameA
- Length385
- Mass (Da)39,499
- Last updated2005-10-25 v2
- Checksum2E2635EDDCA9EFBA
P48810-2
- NameB
- Differences from canonical
- 310-369: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
E1JIK0 | E1JIK0_DROME | Hrb87F | 385 |
Features
Showing features for sequence conflict, compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 241 | in Ref. 2; CAA41170 | ||||
Sequence: A → R | ||||||
Compositional bias | 260-284 | Polar residues | ||||
Sequence: GGSGGWNQQGGSGGGPWNNQGGGNG | ||||||
Sequence conflict | 271 | in Ref. 2; CAA41170/CAA42212 | ||||
Sequence: S → T | ||||||
Sequence conflict | 293 | in Ref. 1, 2 and 3 | ||||
Sequence: G → GG | ||||||
Alternative sequence | VSP_005807 | 310-369 | in isoform B | |||
Sequence: Missing | ||||||
Compositional bias | 322-340 | Polar residues | ||||
Sequence: QSYGGGPQRNSNFGNNRPA | ||||||
Compositional bias | 358-375 | Polar residues | ||||
Sequence: GGQGFAGNNYNTGGGGQG |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X54803 EMBL· GenBank· DDBJ | CAA38574.1 EMBL· GenBank· DDBJ | mRNA | ||
X58183 EMBL· GenBank· DDBJ | CAA41170.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X58184 EMBL· GenBank· DDBJ | CAA41170.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X59691 EMBL· GenBank· DDBJ | CAA42212.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X62636 EMBL· GenBank· DDBJ | CAA44502.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014297 EMBL· GenBank· DDBJ | AAF54967.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014297 EMBL· GenBank· DDBJ | AAN13574.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT012315 EMBL· GenBank· DDBJ | AAS77440.1 EMBL· GenBank· DDBJ | mRNA |