P48558 · BXI1_YEAST
- ProteinBax inhibitor 1
- GeneBXI1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids297 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Links the unfolded protein response and programmed cell death and mediates mitochondrial-dependent apoptosis (PubMed:21673659, PubMed:21673967).
Induces cell death and disruption of the mitochondrial transmembrane potential via the mitochondrial phosphate carrier MIR1 (PubMed:21673659).
Dispensible for starvation-induced autophagy (PubMed:21926971).
Induces cell death and disruption of the mitochondrial transmembrane potential via the mitochondrial phosphate carrier MIR1 (PubMed:21673659).
Dispensible for starvation-induced autophagy (PubMed:21926971).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum | |
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | fungal-type vacuole | |
Cellular Component | membrane | |
Cellular Component | mitochondrial membrane | |
Cellular Component | mitochondrion | |
Cellular Component | vacuolar membrane | |
Biological Process | apoptotic process | |
Biological Process | calcium-mediated signaling | |
Biological Process | endoplasmic reticulum unfolded protein response |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameBax inhibitor 1
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP48558
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Multi-pass membrane protein
Vacuole membrane ; Multi-pass membrane protein
Mitochondrion membrane ; Multi-pass membrane protein
Note: Translocated from predominantly vacuolar sites in healthy cells to mitochondria upon apoptosis induction.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-53 | Lumenal | ||||
Sequence: MSGPPPPYEEQSSHLYGQPASSQDGNAFIPEDFKYSTVVISCEPIIRQRFMHK | ||||||
Transmembrane | 54-74 | Helical | ||||
Sequence: VYSLLSCQLLASLSFCYWASV | ||||||
Topological domain | 75-85 | Cytoplasmic | ||||
Sequence: STSLQNFIMSH | ||||||
Transmembrane | 86-106 | Helical | ||||
Sequence: IALFYICMVVSLVSCIWLAVS | ||||||
Topological domain | 107-146 | Lumenal | ||||
Sequence: PRPEDYEASVPEPLLTGSSEEPAQEQRRLPWYVLSSYKQK | ||||||
Transmembrane | 147-167 | Helical | ||||
Sequence: LTLLSIFTLSEAYCLSLVTLA | ||||||
Topological domain | 168-171 | Cytoplasmic | ||||
Sequence: YDKD | ||||||
Transmembrane | 172-192 | Helical | ||||
Sequence: TVLSALLITTIVVVGVSLTAL | ||||||
Topological domain | 193-208 | Lumenal | ||||
Sequence: SERFENVLNSATSIYY | ||||||
Transmembrane | 209-229 | Helical | ||||
Sequence: WLNWGLWIMIGMGLTALLFGW | ||||||
Topological domain | 230-239 | Cytoplasmic | ||||
Sequence: NTHSSKFNLL | ||||||
Transmembrane | 240-260 | Helical | ||||
Sequence: YGWLGAILFTAYLFIDTQLIF | ||||||
Topological domain | 261-270 | Lumenal | ||||
Sequence: RKVYPDEEVR | ||||||
Transmembrane | 271-291 | Helical | ||||
Sequence: CAMMLYLDIVNLFLSILRILA | ||||||
Topological domain | 292-297 | Cytoplasmic | ||||
Sequence: NSNDDN |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
No effect on autophagy during nitrogen starvation.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 2 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000203369 | 1-297 | Bax inhibitor 1 | |||
Sequence: MSGPPPPYEEQSSHLYGQPASSQDGNAFIPEDFKYSTVVISCEPIIRQRFMHKVYSLLSCQLLASLSFCYWASVSTSLQNFIMSHIALFYICMVVSLVSCIWLAVSPRPEDYEASVPEPLLTGSSEEPAQEQRRLPWYVLSSYKQKLTLLSIFTLSEAYCLSLVTLAYDKDTVLSALLITTIVVVGVSLTALSERFENVLNSATSIYYWLNWGLWIMIGMGLTALLFGWNTHSSKFNLLYGWLGAILFTAYLFIDTQLIFRKVYPDEEVRCAMMLYLDIVNLFLSILRILANSNDDN |
Proteomic databases
PTM databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P48558 | YOL075C Q08234 | 2 | EBI-28349, EBI-29278 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Sequence similarities
Belongs to the BI1 family. LFG subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length297
- Mass (Da)33,645
- Last updated1996-02-01 v1
- Checksum330784DA17152BB0
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 84 | in Ref. 4; AAT92698 | ||||
Sequence: S → A |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U23084 EMBL· GenBank· DDBJ | AAC49093.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z71581 EMBL· GenBank· DDBJ | CAA96233.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY692679 EMBL· GenBank· DDBJ | AAT92698.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006947 EMBL· GenBank· DDBJ | DAA10256.1 EMBL· GenBank· DDBJ | Genomic DNA |