P48545 · KCNJ5_MOUSE
- ProteinG protein-activated inward rectifier potassium channel 4
- GeneKcnj5
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids419 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
This potassium channel is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by external barium.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 179 | Role in the control of polyamine-mediated channel gating and in the blocking by intracellular magnesium | ||||
Sequence: N |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | external side of plasma membrane | |
Cellular Component | I(KACh) inward rectifier potassium channel complex | |
Cellular Component | plasma membrane | |
Cellular Component | T-tubule | |
Molecular Function | G-protein activated inward rectifier potassium channel activity | |
Molecular Function | inward rectifier potassium channel activity | |
Molecular Function | voltage-gated potassium channel activity involved in atrial cardiac muscle cell action potential repolarization | |
Biological Process | membrane repolarization during atrial cardiac muscle cell action potential | |
Biological Process | potassium ion import across plasma membrane | |
Biological Process | potassium ion transmembrane transport | |
Biological Process | regulation of heart rate by cardiac conduction | |
Biological Process | regulation of monoatomic ion transmembrane transport |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameG protein-activated inward rectifier potassium channel 4
- Short namesGIRK-4
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP48545
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane, intramembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-86 | Cytoplasmic | ||||
Sequence: MAGDSRNAMNQDMEIGVTSQDHKKIPKQARDYIPIATDRTRLLTEGKKPRQRYMEKTGKCNVHHGNVQETYRYLSDLFTTLVDLKW | ||||||
Transmembrane | 87-111 | Helical; Name=M1 | ||||
Sequence: RFNLLVFTMVYTITWLFFGFIWWLI | ||||||
Topological domain | 112-135 | Extracellular | ||||
Sequence: AYVRGDLDHVGDQEWIPCVENLSG | ||||||
Intramembrane | 136-147 | Helical; Pore-forming; Name=H5 | ||||
Sequence: FVSAFLFSIETE | ||||||
Intramembrane | 148-154 | Pore-forming | ||||
Sequence: TTIGYGF | ||||||
Topological domain | 155-163 | Extracellular | ||||
Sequence: RVITEKCPE | ||||||
Transmembrane | 164-185 | Helical; Name=M2 | ||||
Sequence: GIILLLVQAILGSIVNAFMVGC | ||||||
Topological domain | 186-419 | Cytoplasmic | ||||
Sequence: MFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIKSRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRAQLEQEEFEVVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEMKRSGRLLQYLPSPPLLGGCAEAGNEAEAEKDEEGEPNGLSVSQATRGSM |
Keywords
- Cellular component
Phenotypes & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 31 variants from UniProt as well as other sources including ClinVar and dbSNP.
Chemistry
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000154935 | 1-419 | G protein-activated inward rectifier potassium channel 4 | |||
Sequence: MAGDSRNAMNQDMEIGVTSQDHKKIPKQARDYIPIATDRTRLLTEGKKPRQRYMEKTGKCNVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTITWLFFGFIWWLIAYVRGDLDHVGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNAFMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIKSRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRAQLEQEEFEVVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEMKRSGRLLQYLPSPPLLGGCAEAGNEAEAEKDEEGEPNGLSVSQATRGSM | ||||||
Modified residue | 5 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Predominantly atrial and pancreatic expression.
Gene expression databases
Interaction
Subunit
May associate with GIRK1 and GIRK2 to form a G-protein-activated heteromultimer pore-forming unit. The resulting inward current is much larger.
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for motif, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 149-154 | Selectivity filter | ||||
Sequence: TIGYGF | ||||||
Region | 388-419 | Disordered | ||||
Sequence: GCAEAGNEAEAEKDEEGEPNGLSVSQATRGSM |
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length419
- Mass (Da)47,669
- Last updated2011-07-27 v3
- Checksum8383373921C7356A
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1L1SRH1 | A0A1L1SRH1_MOUSE | Kcnj5 | 106 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 102 | in Ref. 1; AAB01687 | ||||
Sequence: L → V | ||||||
Sequence conflict | 109 | in Ref. 1; AAB01687 | ||||
Sequence: W → G | ||||||
Sequence conflict | 172 | in Ref. 2; AAC53116 | ||||
Sequence: A → P | ||||||
Sequence conflict | 193 | in Ref. 1; AAB01687 | ||||
Sequence: P → S | ||||||
Sequence conflict | 214 | in Ref. 2; AAC53116 | ||||
Sequence: K → N | ||||||
Sequence conflict | 232 | in Ref. 1; AAB01687 | ||||
Sequence: A → V | ||||||
Sequence conflict | 269 | in Ref. 1; AAB01687 | ||||
Sequence: F → L | ||||||
Sequence conflict | 287 | in Ref. 1; AAB01687 | ||||
Sequence: W → V | ||||||
Sequence conflict | 296 | in Ref. 2; AAC53116 | ||||
Sequence: Q → P | ||||||
Sequence conflict | 351 | in Ref. 2; AAC53116 | ||||
Sequence: F → S |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U33631 EMBL· GenBank· DDBJ | AAB01687.1 EMBL· GenBank· DDBJ | mRNA | ||
AF403131 EMBL· GenBank· DDBJ | AAC53116.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK164058 EMBL· GenBank· DDBJ | BAE37606.1 EMBL· GenBank· DDBJ | mRNA | ||
CH466522 EMBL· GenBank· DDBJ | EDL25354.1 EMBL· GenBank· DDBJ | Genomic DNA |