P48456 · PP2B1_DROME
- ProteinSerine/threonine-protein phosphatase 2B catalytic subunit 1
- GeneCanA1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids622 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca2+-mediated signals (By similarity).
Many of the substrates contain a PxIxIT motif and/or a LxVP motif (By similarity).
This subunit may have a role in the calmodulin activation of calcineurin (Probable). At the periactive zone of synaptic boutons at neuromuscular junctions, promotes formation of phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) microdomains and subsequent synaptic vesicle reformation during Ca2+ channel-dependent activity-dependent bulk endocytosis (ADBE) in response to strong stimulation (PubMed:33300871).
This function may be fwe-dependent (PubMed:33300871).
Many of the substrates contain a PxIxIT motif and/or a LxVP motif (By similarity).
This subunit may have a role in the calmodulin activation of calcineurin (Probable). At the periactive zone of synaptic boutons at neuromuscular junctions, promotes formation of phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) microdomains and subsequent synaptic vesicle reformation during Ca2+ channel-dependent activity-dependent bulk endocytosis (ADBE) in response to strong stimulation (PubMed:33300871).
This function may be fwe-dependent (PubMed:33300871).
Catalytic activity
- H2O + O-phospho-L-seryl-[protein] = L-seryl-[protein] + phosphate
Cofactor
Protein has several cofactor binding sites:
Note: Binds 1 Fe3+ ion per subunit.
Note: Binds 1 zinc ion per subunit.
Features
Showing features for binding site, active site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 130 | Fe cation (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 132 | Fe cation (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 158 | Fe cation (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 158 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 190 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Active site | 191 | Proton donor | ||||
Sequence: H | ||||||
Binding site | 239 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 321 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Site | 392 | Interaction with PxVP motif in substrate | ||||
Sequence: W |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | calcineurin complex | |
Cellular Component | cytoplasm | |
Cellular Component | synaptic vesicle | |
Molecular Function | calcium-dependent protein serine/threonine phosphatase activity | |
Molecular Function | calmodulin binding | |
Molecular Function | calmodulin-dependent protein phosphatase activity | |
Molecular Function | metal ion binding | |
Molecular Function | myosin phosphatase activity | |
Molecular Function | protein serine/threonine phosphatase activity | |
Biological Process | calcineurin-mediated signaling | |
Biological Process | medium-term memory | |
Biological Process | mitophagy | |
Biological Process | negative regulation of epidermal growth factor receptor signaling pathway | |
Biological Process | regulation of innate immune response | |
Biological Process | response to Gram-negative bacterium | |
Biological Process | response to nitric oxide | |
Biological Process | sleep |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSerine/threonine-protein phosphatase 2B catalytic subunit 1
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionP48456
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown in neurons reduces activation of phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) in the synaptic boutons of larval neuromuscular junctions (NMJs), in response to high K+ stimuli that induces activity-dependent bulk endocytosis (ADBE) (PubMed:33300871).
Under conditions of strong stimuli, the synaptic boutons displays reduced formation of PtdIns(4,5)P2 microdomains at periactive zones and consequently exhibits an impaired Ca2+ response (PubMed:33300871).
Under conditions of strong stimuli, the synaptic boutons displays reduced formation of PtdIns(4,5)P2 microdomains at periactive zones and consequently exhibits an impaired Ca2+ response (PubMed:33300871).
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000058830 | 1-622 | Serine/threonine-protein phosphatase 2B catalytic subunit 1 | |||
Sequence: MSATSTRSSVTRKSSLSKSSSSDKSAKSSSNSSKSPTAASGNKQKMQYTKTRERMVDDVPLPPTHKLTMSEVYDDPKTGKPNFDALRQHFLLEGRIEEAVALRIITEGAALLREEKNMIDVEAPITVCGDIHGQFFDLVKLFEVGGPPATTRYLFLGDYVDRGYFSIECVLYLWSLKITYPTTLSLLRGNHECRHLTEYFTFKQECIIKYSESIYDACMEAFDCLPLAALLNQQFLCIHGGLSPEIFTLDDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTNEFFSHNSVRGCSYFFSYSACCEFLQKNNLLSIVRAHEAQDAGYRMYRKNQVTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNILNICSDDELVAGPDDELEEELRKKIVLVPANASNNNNNNNTPSKPASMSALRKEIIRNKIRAIGKMSRVFSILREESESVLQLKGLTPTGALPVGALSGGRDSLKEALQGLTASSHIHSFAEAKGLDAVNERMPPRRPLLMSASSSSITTVTRSSSSSSNNNNNNSNTSSTTTTKDISNTSSNDTATVTKTSRTTVKSATTSNVRAGFTAKKFP | ||||||
Modified residue | 264 | 3'-nitrotyrosine | ||||
Sequence: Y | ||||||
Modified residue | 527 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 567 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-46 | Polar residues | ||||
Sequence: MSATSTRSSVTRKSSLSKSSSSDKSAKSSSNSSKSPTAASGNKQKM | ||||||
Region | 1-74 | Disordered | ||||
Sequence: MSATSTRSSVTRKSSLSKSSSSDKSAKSSSNSSKSPTAASGNKQKMQYTKTRERMVDDVPLPPTHKLTMSEVYD | ||||||
Motif | 347-351 | SAPNY motif | ||||
Sequence: SAPNY | ||||||
Region | 545-606 | Disordered | ||||
Sequence: RPLLMSASSSSITTVTRSSSSSSNNNNNNSNTSSTTTTKDISNTSSNDTATVTKTSRTTVKS | ||||||
Compositional bias | 548-606 | Polar residues | ||||
Sequence: LMSASSSSITTVTRSSSSSSNNNNNNSNTSSTTTTKDISNTSSNDTATVTKTSRTTVKS |
Sequence similarities
Belongs to the PPP phosphatase family. PP-2B subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length622
- Mass (Da)69,133
- Last updated2005-08-30 v2
- ChecksumFAD967D2123EFAE9
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0B4K6V6 | A0A0B4K6V6_DROME | CanA1 | 622 | ||
A0A0B4K6N5 | A0A0B4K6N5_DROME | CanA1 | 596 |
Sequence caution
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-46 | Polar residues | ||||
Sequence: MSATSTRSSVTRKSSLSKSSSSDKSAKSSSNSSKSPTAASGNKQKM | ||||||
Sequence conflict | 459 | in Ref. 4; AAA28410 | ||||
Sequence: L → V | ||||||
Compositional bias | 548-606 | Polar residues | ||||
Sequence: LMSASSSSITTVTRSSSSSSNNNNNNSNTSSTTTTKDISNTSSNDTATVTKTSRTTVKS | ||||||
Sequence conflict | 622 | in Ref. 4; AAA28410 | ||||
Sequence: P → S |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE014297 EMBL· GenBank· DDBJ | AAF57105.3 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY128480 EMBL· GenBank· DDBJ | AAM75073.1 EMBL· GenBank· DDBJ | mRNA | ||
M97012 EMBL· GenBank· DDBJ | AAA28410.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
S39996 EMBL· GenBank· DDBJ | AAB22466.1 EMBL· GenBank· DDBJ | Genomic DNA |