P48182 · ACR2_CAEEL
- ProteinAcetylcholine receptor subunit beta-type acr-2
- Geneacr-2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids575 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Non-alpha subunit of nicotinic acetylcholine receptor (nAChR) (PubMed:20027209, PubMed:8581398).
Acts in cholinergic motoneurons to regulate presynaptic neurotransmitter release, thereby ensuring normal level of excitation of cholinergic motoneurons during locomotion (PubMed:20027209, PubMed:23658528, PubMed:27782882).
Acts in cholinergic motoneurons to regulate presynaptic neurotransmitter release, thereby ensuring normal level of excitation of cholinergic motoneurons during locomotion (PubMed:20027209, PubMed:23658528, PubMed:27782882).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | acetylcholine-gated channel complex | |
Cellular Component | neuron projection | |
Cellular Component | plasma membrane | |
Cellular Component | postsynaptic membrane | |
Cellular Component | synapse | |
Molecular Function | acetylcholine-gated monoatomic cation-selective channel activity | |
Molecular Function | excitatory extracellular ligand-gated monoatomic ion channel activity | |
Molecular Function | transmembrane signaling receptor activity | |
Molecular Function | transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential | |
Biological Process | calcium ion import across plasma membrane | |
Biological Process | inorganic cation transmembrane transport | |
Biological Process | neuromuscular synaptic transmission | |
Biological Process | positive regulation of translation | |
Biological Process | regulation of gene expression | |
Biological Process | regulation of locomotion | |
Biological Process | regulation of muscle contraction |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameAcetylcholine receptor subunit beta-type acr-2
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionP48182
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Postsynaptic cell membrane ; Multi-pass membrane protein
Cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 21-270 | Extracellular | ||||
Sequence: NGGHDDEAADFLSHTNIDDPNNSSDPNKNSDQGDTMGEDEDRLVIDLFREYNFLIRPVKNVSSPPVVVDFGVAMILLINVDEKNQILQTNVWLTMKWNDFQLAWNPAEYGNISNLHVPSDRVWLPDIVLFNNADGNYEVSFKSNVFVDHHGDVTWVPPAMFKSSCRIDVEWFPFDEQCCTLVFGSWTYNSEEVRLHWYNNIQAVQLHDYSYSGIWDVIDVPGQLVHKPDLKENKMVFNVVIRRKTLFYTV | ||||||
Transmembrane | 271-291 | Helical | ||||
Sequence: ILIIPTVLMAFLSVMAFYLPV | ||||||
Transmembrane | 299-319 | Helical | ||||
Sequence: LTISLLLALVVFLLLVSKILP | ||||||
Transmembrane | 331-351 | Helical | ||||
Sequence: LLLAFVLNITAVVGTVVIVNI | ||||||
Topological domain | 352-527 | Cytoplasmic | ||||
Sequence: YFRSALSHKMPTWVRKVFLEFLPHLLVMKRPERIPIFNGYFVEEYCASEIFDASLVMPSMTATMLPFLQVTTNLKAASSTSSGQSSEHHENCSKWKKRLSIRMSKRRAPRARLDDDSEDIIDDTNGNHVDSLQEKISKEMKTTVEAIAYIAEHMKREMSLKKMRDDWKYVAMVLDR | ||||||
Transmembrane | 528-548 | Helical | ||||
Sequence: LILLIFFGVTLGGTLGIICSA |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Locomotion is slower. Moderately resistant to paralysis induced by acetylcholine esterase inhibitor aldicarb but sensitivity to acetylcholine agonist levamisole is normal. Reduced both cholinergic and GABAergic motoneuron activities characterized by a reduction in miniature postsynaptic currents in muscles.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 309 | In n2420; constitutively active. Spontaneous convulsions and shrinking behavior in response to touch. Convulsions are suppressed in an unc-74, unc-50, unc-38 or unc-63 mutant background. Enhanced neurotransmitter release by cholinergic motoneurons and reduced neurotransmitter release by GABAergic motoneurons. Increases neuropeptide flp-18 expression in cholinergic B-type motor neurons. Increases sensitivity to paralysis induced by acetylcholine esterase inhibitor aldicarb or acetylcholine agonist levamisole in L3-L4 larvae and adults. | ||||
Sequence: V → M |
PTM/Processing
Features
Showing features for signal, chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MKKTVKILLILITVFLKVHC | ||||||
Chain | PRO_0000000398 | 21-575 | Acetylcholine receptor subunit beta-type acr-2 | |||
Sequence: NGGHDDEAADFLSHTNIDDPNNSSDPNKNSDQGDTMGEDEDRLVIDLFREYNFLIRPVKNVSSPPVVVDFGVAMILLINVDEKNQILQTNVWLTMKWNDFQLAWNPAEYGNISNLHVPSDRVWLPDIVLFNNADGNYEVSFKSNVFVDHHGDVTWVPPAMFKSSCRIDVEWFPFDEQCCTLVFGSWTYNSEEVRLHWYNNIQAVQLHDYSYSGIWDVIDVPGQLVHKPDLKENKMVFNVVIRRKTLFYTVILIIPTVLMAFLSVMAFYLPVDSGEKVSLTISLLLALVVFLLLVSKILPPTSNIPLMGKYLLLAFVLNITAVVGTVVIVNIYFRSALSHKMPTWVRKVFLEFLPHLLVMKRPERIPIFNGYFVEEYCASEIFDASLVMPSMTATMLPFLQVTTNLKAASSTSSGQSSEHHENCSKWKKRLSIRMSKRRAPRARLDDDSEDIIDDTNGNHVDSLQEKISKEMKTTVEAIAYIAEHMKREMSLKKMRDDWKYVAMVLDRLILLIFFGVTLGGTLGIICSAPHVFDFVDQEAIISKLNAKYLPSDMYS | ||||||
Glycosylation | 41 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 42 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 80 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 131 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 185↔199 | |||||
Sequence: CRIDVEWFPFDEQCC |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Specifically expressed in cholinergic ventral cord motoneurons of the VA, VB, DA and DB classes but not AS and VC classes. Expressed in PVQ and DVC neurons in the tail.
Developmental stage
Expressed from L1 larval stage through adults.
Gene expression databases
Interaction
Subunit
Component of nicotinic acetylcholine receptor. In cholinergic motoneurons, composed of 2 non-alpha subunits acr-2 and acr-3, and 3 alpha subunits unc-38, unc-63 and acr-12.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 31-57 | Disordered | ||||
Sequence: FLSHTNIDDPNNSSDPNKNSDQGDTMG | ||||||
Compositional bias | 35-51 | Polar residues | ||||
Sequence: TNIDDPNNSSDPNKNSD |
Sequence similarities
Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length575
- Mass (Da)65,595
- Last updated1996-02-01 v1
- Checksum7EB24296100EEB05
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 35-51 | Polar residues | ||||
Sequence: TNIDDPNNSSDPNKNSD |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X86403 EMBL· GenBank· DDBJ | CAA60157.1 EMBL· GenBank· DDBJ | mRNA | ||
FO081325 EMBL· GenBank· DDBJ | CCD70794.1 EMBL· GenBank· DDBJ | Genomic DNA |