P48148 · RHO1_DROME
- ProteinRas-like GTP-binding protein Rho1
- GeneRho1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids192 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Has a role in regulating actin cytoskeletal organization: required during early development for proper execution of morphogenetic movements of individual cells and groups of cells important for the formation of the embryonic body plan (PubMed:10556060, PubMed:24535826, PubMed:25739458).
Plays a role in regulating dorsal closure during embryogenesis (PubMed:10323867, PubMed:10556060).
During axis elongation, required for Rho-kinase Rok planar polarity and adherens junction localization as well as for generating a planar polarized distribution of the actin-binding protein Shrm (PubMed:24535826).
During embryogenesis, acts upstream of wash to regulate the developmental migration of tail hemocytes anteriorly along the ventral midline (PubMed:25739458).
May have a role in eye development (PubMed:7835340).
Involved in targeted recruitment of dia/diaphanous to apical membranes of polarized epithelial cells (PubMed:23853710).
Plays a role in regulating dorsal closure during embryogenesis (PubMed:10323867, PubMed:10556060).
During axis elongation, required for Rho-kinase Rok planar polarity and adherens junction localization as well as for generating a planar polarized distribution of the actin-binding protein Shrm (PubMed:24535826).
During embryogenesis, acts upstream of wash to regulate the developmental migration of tail hemocytes anteriorly along the ventral midline (PubMed:25739458).
May have a role in eye development (PubMed:7835340).
Involved in targeted recruitment of dia/diaphanous to apical membranes of polarized epithelial cells (PubMed:23853710).
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRas-like GTP-binding protein Rho1
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionP48148
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Lipid-anchor
Apical cell membrane ; Lipid-anchor
Lateral cell membrane ; Lipid-anchor
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Embryonic lethal. Embryos exhibit severe defects in head involution and imperfect dorsal closure. During head involution, the head structures fail to internalize resulting in holes in the dorsal anterior region of the cuticle. The disruption in the dorsal surface stretches the ventral surface, causing the cuticle to bow.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 27-29 | Reduces binding to wash. Reduces the number of hemocytes migrating anteriorly from the tail during embryogenesis. | ||||
Sequence: KDQ → AAA | ||||||
Mutagenesis | 39 | No effect on binding to wash and no effect on tail hemocyte developmental migration from the tail. | ||||
Sequence: F → V | ||||||
Mutagenesis | 51-54 | No effect on binding to wash. | ||||
Sequence: KQVE → AAAA |
PTM/Processing
Features
Showing features for chain, modified residue, lipidation, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000198885 | 1-189 | Ras-like GTP-binding protein Rho1 | |||
Sequence: MTTIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKKRKKTRC | ||||||
Modified residue | 189 | Cysteine methyl ester | ||||
Sequence: C | ||||||
Lipidation | 189 | S-geranylgeranyl cysteine | ||||
Sequence: C | ||||||
Propeptide | PRO_0000281238 | 190-192 | Removed in mature form | |||
Sequence: LLL |
Keywords
- PTM
Proteomic databases
Expression
Interaction
Subunit
Interacts with capu (PubMed:10556060).
Interacts (via REM repeats) with Pkn (via N-terminus) (PubMed:10323867, PubMed:17507675).
Interacts (via N-terminus) with wash (via N-terminus) (PubMed:25739458).
May interact with dia/diaphanous (via CBD/FH3 domain) (PubMed:23853710).
Interacts (via REM repeats) with Pkn (via N-terminus) (PubMed:10323867, PubMed:17507675).
Interacts (via N-terminus) with wash (via N-terminus) (PubMed:25739458).
May interact with dia/diaphanous (via CBD/FH3 domain) (PubMed:23853710).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 34-42 | Effector region | ||||
Sequence: YVPTVFENY |
Sequence similarities
Belongs to the small GTPase superfamily. Rho family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length192
- Mass (Da)21,723
- Last updated1996-02-01 v1
- ChecksumB89C7D884E1743CF
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L38311 EMBL· GenBank· DDBJ | AAA67042.1 EMBL· GenBank· DDBJ | mRNA | ||
AF177871 EMBL· GenBank· DDBJ | AAF01183.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF177872 EMBL· GenBank· DDBJ | AAF01184.1 EMBL· GenBank· DDBJ | mRNA | ||
AF177873 EMBL· GenBank· DDBJ | AAF01185.1 EMBL· GenBank· DDBJ | mRNA | ||
AF177874 EMBL· GenBank· DDBJ | AAF01186.1 EMBL· GenBank· DDBJ | mRNA | ||
AE013599 EMBL· GenBank· DDBJ | AAM70944.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE013599 EMBL· GenBank· DDBJ | AAM70945.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE013599 EMBL· GenBank· DDBJ | AAM70946.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE013599 EMBL· GenBank· DDBJ | AAS64843.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE013599 EMBL· GenBank· DDBJ | AAS64844.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY119536 EMBL· GenBank· DDBJ | AAM50190.1 EMBL· GenBank· DDBJ | mRNA | ||
BT010085 EMBL· GenBank· DDBJ | AAQ22554.1 EMBL· GenBank· DDBJ | mRNA |