P47977 · CTH2_YEAST
- ProteinmRNA decay factor CTH2
- GeneTIS11
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids285 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Binds to specific AU-rich elements (ARE) in the 3'-untranslated region of target mRNAs and promotes their degradation. In response to iron deficiency, promotes the decay of many mRNAs encoding proteins involved in iron-dependent pathways. Recruits the DHH1 helicase to the SDH4 mRNA and promotes SDH4 mRNA decay. Also destabilizes target mRNA by modulating 3'-end processing, creating extended transcripts that are prone for degradation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | mitochondrion | |
Cellular Component | nucleus | |
Cellular Component | P-body | |
Molecular Function | metal ion binding | |
Molecular Function | mRNA binding | |
Molecular Function | translation repressor activity | |
Biological Process | electron transport coupled proton transport | |
Biological Process | intracellular iron ion homeostasis | |
Biological Process | negative regulation of cytoplasmic translation | |
Biological Process | nuclear-transcribed mRNA catabolic process | |
Biological Process | response to iron ion starvation |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namemRNA decay factor CTH2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP47977
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 190 | Abolishes mRNA binding. | ||||
Sequence: C → A or R | ||||||
Mutagenesis | 213 | Abolishes mRNA binding. | ||||
Sequence: C → A or R |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 8 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000089174 | 1-285 | mRNA decay factor CTH2 | |||
Sequence: MWAQLSYTRPESQKTDLTSLFSTDQEQNPLNDYQYQINIRELEEYYNKTILNEDNIQETSSEISSAVSFSPPKNTNAIQPGLLYDPQLMNPFLPSAHLNSTAPTTFKKKLEVQINPDYVPKSSQLPLTSQNLQQLSQQKPKNDASFSSEKESSAQPKVKSQVQETPKQLYKTELCESFTLKGSCPYGSKCQFAHGLGELKVKKSCKNFRTKPCVNWEKLGYCPYGRRCCFKHGDDNDIAVYVKAGTYCNVSSTSKQSDEKRSNGRGSAKKKNLNVKVKALQRMTW |
Proteomic databases
PTM databases
Expression
Induction
By transcription factors AFT1 and AFT2 in response to iron deficiency.
Structure
Family & Domains
Features
Showing features for region, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 37-55 | Required for mRNA decay activity | ||||
Sequence: INIRELEEYYNKTILNEDN | ||||||
Region | 132-164 | Disordered | ||||
Sequence: LQQLSQQKPKNDASFSSEKESSAQPKVKSQVQE | ||||||
Zinc finger | 169-197 | C3H1-type 1 | ||||
Sequence: LYKTELCESFTLKGSCPYGSKCQFAHGLG | ||||||
Zinc finger | 207-235 | C3H1-type 2 | ||||
Sequence: NFRTKPCVNWEKLGYCPYGRRCCFKHGDD | ||||||
Region | 252-271 | Disordered | ||||
Sequence: STSKQSDEKRSNGRGSAKKK |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length285
- Mass (Da)32,314
- Last updated1996-10-01 v1
- Checksum72E041AE31EC4099
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
S76619 EMBL· GenBank· DDBJ | AAB33266.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
L42134 EMBL· GenBank· DDBJ | AAB39898.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X91258 EMBL· GenBank· DDBJ | CAA62651.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z73308 EMBL· GenBank· DDBJ | CAA97707.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U53881 EMBL· GenBank· DDBJ | AAB82400.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY558210 EMBL· GenBank· DDBJ | AAS56536.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006945 EMBL· GenBank· DDBJ | DAA09447.1 EMBL· GenBank· DDBJ | Genomic DNA |