P47056 · IRC18_YEAST
- ProteinOuter spore wall protein 6
- GeneIRC18
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids224 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Involved in spore wall assembly.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | fungal-type vacuole | |
Cellular Component | membrane | |
Biological Process | ascospore wall assembly |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameOuter spore wall protein 6
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP47056
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 27-174 | Extracellular | ||||
Sequence: VVEFESTGTKLVNSLRVLAAYSQSSVCVDEKISGIERQIEEVKDMYGNHSFILKGLNGILNNKVNMLTREIQMETVGNNTFETETGKLTKGLNRAVNISPFKYIKKFKTVSTKKFESLLNKYDLVAKKGGELTEEQKKKKEVLSRISR | ||||||
Transmembrane | 175-195 | Helical | ||||
Sequence: VVAATTIEAGLAQGVVDLCIT | ||||||
Topological domain | 196-199 | Cytoplasmic | ||||
Sequence: VTTS | ||||||
Transmembrane | 200-220 | Helical | ||||
Sequence: LCLVSASIGGVGFLIWLTIIY | ||||||
Topological domain | 221-224 | Extracellular | ||||
Sequence: QALT |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Displays increased levels of spontaneous RAD52 foci in proliferating diploid cells (PubMed:18085829).
A combined deletion of the LOH1/OSW4 and IRC18/OSW6 has reduced dityrosine incorporation in the outer spore wall (PubMed:23966878).
A combined deletion of the LOH1/OSW4 and IRC18/OSW6 has reduced dityrosine incorporation in the outer spore wall (PubMed:23966878).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 2 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-26 | |||||
Sequence: MKVQMIERIFLIQLCLLTVVLASSRA | ||||||
Chain | PRO_0000203069 | 27-224 | Outer spore wall protein 6 | |||
Sequence: VVEFESTGTKLVNSLRVLAAYSQSSVCVDEKISGIERQIEEVKDMYGNHSFILKGLNGILNNKVNMLTREIQMETVGNNTFETETGKLTKGLNRAVNISPFKYIKKFKTVSTKKFESLLNKYDLVAKKGGELTEEQKKKKEVLSRISRVVAATTIEAGLAQGVVDLCITVTTSLCLVSASIGGVGFLIWLTIIYQALT | ||||||
Glycosylation | 74 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 104 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Induction
In respiratory-deficient cells and by heat.
Structure
Family & Domains
Sequence similarities
Belongs to the OSW4/6 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length224
- Mass (Da)24,746
- Last updated1996-02-01 v1
- Checksum6C17841176EADC1F
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z49312 EMBL· GenBank· DDBJ | CAA89328.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY558244 EMBL· GenBank· DDBJ | AAS56570.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006943 EMBL· GenBank· DDBJ | DAA08762.1 EMBL· GenBank· DDBJ | Genomic DNA |