P46734 · MP2K3_HUMAN
- ProteinDual specificity mitogen-activated protein kinase kinase 3
- GeneMAP2K3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids347 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Catalytic activity
- ATP + L-seryl-[protein] = ADP + H+ + O-phospho-L-seryl-[protein]
Activity regulation
Features
Showing features for binding site, active site.
GO annotations
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDual specificity mitogen-activated protein kinase kinase 3
- EC number
- Short namesMAP kinase kinase 3; MAPKK 3
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP46734
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Involvement in disease
Features
Showing features for natural variant, mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_040817 | 26 | ||||
Sequence: R → T | ||||||
Natural variant | VAR_046062 | 40 | in dbSNP:rs33911218 | |||
Sequence: P → T | ||||||
Natural variant | VAR_061742 | 55 | in dbSNP:rs36047035 | |||
Sequence: R → T | ||||||
Natural variant | VAR_046063 | 68 | in dbSNP:rs34105301 | |||
Sequence: S → P | ||||||
Natural variant | VAR_046064 | 84 | in dbSNP:rs2305873 | |||
Sequence: A → T | ||||||
Natural variant | VAR_046065 | 90 | in dbSNP:rs36076766 | |||
Sequence: M → I | ||||||
Natural variant | VAR_046066 | 94 | in dbSNP:rs56067280 | |||
Sequence: R → L | ||||||
Natural variant | VAR_046067 | 96 | in dbSNP:rs56216806 | |||
Sequence: R → W | ||||||
Natural variant | VAR_014208 | 175 | in colon cancer; dbSNP:rs1339756947 | |||
Sequence: R → W | ||||||
Natural variant | VAR_014209 | 215 | in colon cancer; dbSNP:rs989026404 | |||
Sequence: L → V | ||||||
Mutagenesis | 218 | Inactivation. | ||||
Sequence: S → A | ||||||
Mutagenesis | 218 | Constitutive activation. | ||||
Sequence: S → E | ||||||
Mutagenesis | 222 | Inactivation. | ||||
Sequence: T → A | ||||||
Mutagenesis | 222 | Constitutive activation. | ||||
Sequence: T → E | ||||||
Natural variant | VAR_046068 | 293 | in dbSNP:rs35206134 | |||
Sequence: R → H | ||||||
Natural variant | VAR_046069 | 339 | in dbSNP:rs2363198 | |||
Sequence: V → M |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 556 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue, chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue | 1 | UniProt | N-acetylmethionine | ||||
Sequence: M | |||||||
Chain | PRO_0000086378 | 1-347 | UniProt | Dual specificity mitogen-activated protein kinase kinase 3 | |||
Sequence: MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS | |||||||
Modified residue | 3 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 15 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 15 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 28 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 31 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 39 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 214 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue | 218 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 218 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 222 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 253 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Phosphorylated by TAOK2 (PubMed:11279118).
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Gene expression databases
Organism-specific databases
Interaction
Subunit
Binds to DYRK1B/MIRK and increases its kinase activity (PubMed:11980910).
Part of a complex with MAP3K3, RAC1 and CCM2 (By similarity).
Interacts with ARRB1 (PubMed:16709866).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P46734 | DYRK1B Q9Y463 | 2 | EBI-602462, EBI-634187 | |
BINARY | P46734 | LRRK2 Q5S007 | 5 | EBI-602462, EBI-5323863 | |
BINARY | P46734 | MAP3K5 Q99683 | 6 | EBI-602462, EBI-476263 | |
BINARY | P46734 | MAPK14 Q16539 | 7 | EBI-602462, EBI-73946 | |
BINARY | P46734 | TINF2 Q9BSI4 | 2 | EBI-602462, EBI-717399 |
Protein-protein interaction databases
Chemistry
Miscellaneous
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-15 | Polar residues | ||||
Sequence: MESPASSQPASMPQS | ||||||
Region | 1-46 | Disordered | ||||
Sequence: MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDS | ||||||
Domain | 64-325 | Protein kinase | ||||
Sequence: LVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFF |
Sequence similarities
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
P46734-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name3
- Synonyms3b
- Length347
- Mass (Da)39,318
- Last updated2002-11-01 v2
- ChecksumA80BA4FDFF8F75A2
P46734-2
- Name1
- Differences from canonical
- 1-29: Missing
P46734-3
- Name2
- Synonyms3c
- Differences from canonical
- 1-16: MESPASSQPASMPQSK → MGVQGTLMSRDSQTPHLLSIL
Computationally mapped potential isoform sequences
There are 6 potential isoforms mapped to this entry
Features
Showing features for compositional bias, alternative sequence, sequence conflict.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L36719 EMBL· GenBank· DDBJ | AAC41718.1 EMBL· GenBank· DDBJ | mRNA | ||
D87116 EMBL· GenBank· DDBJ | BAA13248.1 EMBL· GenBank· DDBJ | mRNA | ||
U66839 EMBL· GenBank· DDBJ | AAB40652.1 EMBL· GenBank· DDBJ | mRNA | ||
U66840 EMBL· GenBank· DDBJ | AAB40653.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK093838 EMBL· GenBank· DDBJ | BAG52769.1 EMBL· GenBank· DDBJ | mRNA | ||
BC032478 EMBL· GenBank· DDBJ | AAH32478.1 EMBL· GenBank· DDBJ | mRNA |