P46694 · IEX1_MOUSE
- ProteinRadiation-inducible immediate-early gene IEX-1
- GeneIer3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids160 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May play a role in the ERK signaling pathway by inhibiting the dephosphorylation of ERK by phosphatase PP2A-PPP2R5C holoenzyme. Acts also as an ERK downstream effector mediating survival (By similarity).
As a member of the NUPR1/RELB/IER3 survival pathway, may allow the development of pancreatic intraepithelial neoplasias
As a member of the NUPR1/RELB/IER3 survival pathway, may allow the development of pancreatic intraepithelial neoplasias
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Cellular Component | mitochondrion | |
Cellular Component | nucleus | |
Biological Process | DNA damage response | |
Biological Process | glycolytic process | |
Biological Process | intrinsic apoptotic signaling pathway in response to DNA damage | |
Biological Process | mitotic G2 DNA damage checkpoint signaling | |
Biological Process | negative regulation of glycolytic process | |
Biological Process | negative regulation of inflammatory response | |
Biological Process | negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway | |
Biological Process | negative regulation of systemic arterial blood pressure | |
Biological Process | positive regulation of protein catabolic process | |
Biological Process | regulation of DNA repair | |
Biological Process | regulation of nucleocytoplasmic transport | |
Biological Process | regulation of reactive oxygen species metabolic process | |
Biological Process | response to protozoan |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRadiation-inducible immediate-early gene IEX-1
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP46694
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Single-pass type II membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-85 | Cytoplasmic | ||||
Sequence: MCHSRNHLHTMTGLRAPSPAPSTGPELRRGSGPEIFTFDPLPERAVVSTARLNTSRGHRKRSRRVLYPRVVRRQLPTEEPNIAKR | ||||||
Transmembrane | 86-102 | Helical; Signal-anchor for type II membrane protein | ||||
Sequence: VLFLLFAIIFCQILMAE | ||||||
Topological domain | 103-153 | Extracellular | ||||
Sequence: EGVSQPLAPEDATSAVTPEPISAPITAPPVLEPLNLTSESSDYALDLKAFL |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000084160 | 1-160 | Radiation-inducible immediate-early gene IEX-1 | |||
Sequence: MCHSRNHLHTMTGLRAPSPAPSTGPELRRGSGPEIFTFDPLPERAVVSTARLNTSRGHRKRSRRVLYPRVVRRQLPTEEPNIAKRVLFLLFAIIFCQILMAEEGVSQPLAPEDATSAVTPEPISAPITAPPVLEPLNLTSESSDYALDLKAFLQQHPAAF | ||||||
Modified residue | 31 | Phosphoserine | ||||
Sequence: S | ||||||
Glycosylation | 137 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Post-translational modification
Glycosylated.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed predominantly in the lung, testes and the uterus.
Induction
By serum growth factors and TPA.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-35 | Disordered | ||||
Sequence: MCHSRNHLHTMTGLRAPSPAPSTGPELRRGSGPEI |
Sequence similarities
Belongs to the IER3 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length160
- Mass (Da)17,655
- Last updated2022-02-23 v2
- Checksum0666DF96E751FCF4
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 134 | in Ref. 4; CAJ18479 | ||||
Sequence: E → G |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X67644 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
AY168443 EMBL· GenBank· DDBJ | AAO39405.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK051003 EMBL· GenBank· DDBJ | BAC34493.1 EMBL· GenBank· DDBJ | mRNA | ||
AK170477 EMBL· GenBank· DDBJ | BAE41821.1 EMBL· GenBank· DDBJ | mRNA | ||
CT010247 EMBL· GenBank· DDBJ | CAJ18455.1 EMBL· GenBank· DDBJ | mRNA | ||
CT010271 EMBL· GenBank· DDBJ | CAJ18479.1 EMBL· GenBank· DDBJ | mRNA | ||
GL456179 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC006950 EMBL· GenBank· DDBJ | AAH06950.1 EMBL· GenBank· DDBJ | mRNA |