P43618 · CENPT_YEAST
- ProteinInner kinetochore subunit CNN1
- GeneCNN1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids361 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the kinetochore, a multiprotein complex that assembles on centromeric DNA and attaches chromosomes to spindle microtubules, mediating chromosome segregation and sister chromatid segregation during meiosis and mitosis. Component of the inner kinetochore constitutive centromere-associated network (CCAN), which serves as a structural platform for outer kinetochore assembly (PubMed:22561346).
CNN1 is important for the recruitment of the outer kinetochore Ndc80 complex (PubMed:23334295).
CNN1 is important for the recruitment of the outer kinetochore Ndc80 complex (PubMed:23334295).
Miscellaneous
Present with 1300 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | kinetochore | |
Cellular Component | nucleus | |
Molecular Function | centromeric DNA binding | |
Molecular Function | protein-containing complex binding | |
Biological Process | cell division | |
Biological Process | chromosome segregation | |
Biological Process | negative regulation of kinetochore assembly |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameInner kinetochore subunit CNN1
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP43618
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 74 | Increases interaction with SPC24-SPC25. | ||||
Sequence: S → A | ||||||
Mutagenesis | 74 | Abolishes interaction with SPC24-SPC25. | ||||
Sequence: S → D |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 10 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000202697 | 1-361 | Inner kinetochore subunit CNN1 | |||
Sequence: MSTPRKAAGNNENTEVSEIRTPFRERALEEQRLKDEVLIRNTPGYRKLLSASTKSHDILNKDPNEVRSFLQDLSQVLARKSQGNDTTTNKTQARNLIDELAYEESQPEENELLRSRSEKLTDNNIGNETQPDYTSLSQTVFAKLQERDKGLKSRKIDPIIIQDVPTTGHEDELTVHSPDKANSISMEVLRTSPSIGMDQVDEPPVRDPVPISITQQEEPLSEDLPSDDKEETEEAENEDYSFENTSDENLDDIGNDPIRLNVPAVRRSSIKPLQIMDLKHLTRQFLNENRIILPKQTWSTIQEESLNIMDFLKQKIGTLQKQELVDSFIDMGIINNVDDMFELAHELLPLELQSRIESYLF | ||||||
Modified residue | 2 | Phosphoserine; by CDK1 | ||||
Sequence: S | ||||||
Modified residue | 14 | Phosphothreonine; by CDK1 and MPS1 | ||||
Sequence: T | ||||||
Modified residue | 17 | Phosphoserine; by CDK1 and MPS1 | ||||
Sequence: S | ||||||
Modified residue | 21 | Phosphothreonine; by CDK1 | ||||
Sequence: T | ||||||
Modified residue | 42 | Phosphothreonine; by CDK1 | ||||
Sequence: T | ||||||
Modified residue | 50 | Phosphoserine; by CDK1 and MPS1 | ||||
Sequence: S | ||||||
Modified residue | 52 | Phosphoserine; by CDK1 | ||||
Sequence: S | ||||||
Modified residue | 53 | Phosphothreonine; by MPS1 | ||||
Sequence: T | ||||||
Modified residue | 55 | Phosphoserine; by CDK1 | ||||
Sequence: S | ||||||
Modified residue | 74 | Phosphoserine; by CDK1 and MPS1 | ||||
Sequence: S | ||||||
Modified residue | 86 | Phosphothreonine; by MPS1 | ||||
Sequence: T | ||||||
Modified residue | 88 | Phosphothreonine; by MPS1 | ||||
Sequence: T | ||||||
Modified residue | 91 | Phosphothreonine; by CDK1 and MPS1 | ||||
Sequence: T | ||||||
Modified residue | 115 | Phosphoserine; by CDK1 | ||||
Sequence: S | ||||||
Modified residue | 129 | Phosphothreonine; by CDK1 and MPS1 | ||||
Sequence: T | ||||||
Modified residue | 134 | Phosphothreonine; by MPS1 | ||||
Sequence: T | ||||||
Modified residue | 135 | Phosphoserine; by MPS1 | ||||
Sequence: S | ||||||
Modified residue | 139 | Phosphothreonine; by CDK1 and MPS1 | ||||
Sequence: T | ||||||
Modified residue | 153 | Phosphoserine; by MPS1 | ||||
Sequence: S | ||||||
Modified residue | 174 | Phosphothreonine; by MPS1 | ||||
Sequence: T | ||||||
Modified residue | 177 | Phosphoserine; by CDK1 | ||||
Sequence: S | ||||||
Modified residue | 191 | Phosphothreonine; by CDK1 | ||||
Sequence: T | ||||||
Modified residue | 192 | Phosphoserine; by CDK1 | ||||
Sequence: S | ||||||
Modified residue | 268 | Phosphoserine; by CDK1 | ||||
Sequence: S |
Post-translational modification
Phosphorylation of the C-ter by MPS1 kinase regulates interaction with the outer kinetochore Ndc80 complex.
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Component of the inner kinetochore constitutive centromere-associated network (CCAN) (also known as central kinetochore CTF19 complex in yeast), which is composed of at least AME1, CHL4, CNN1, CTF3, CTF19, IML3, MCM16, MCM21, MCM22, MHF1, MHF2, MIF2, NKP1, NKP2, OKP1 and WIP1 (PubMed:14633972, PubMed:22561346).
Interacts with outer kinetochore MIND complex subunit NNF1 (PubMed:14633972).
Interacts with outer kinetochore Ndc80 complex subunits SPC24 and SPC25 (PubMed:22561346, PubMed:23334295).
Interacts with outer kinetochore MIND complex subunit NNF1 (PubMed:14633972).
Interacts with outer kinetochore Ndc80 complex subunits SPC24 and SPC25 (PubMed:22561346, PubMed:23334295).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P43618 | NUF2 P33895 | 2 | EBI-23036, EBI-12377 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-17 | Polar residues | ||||
Sequence: MSTPRKAAGNNENTEVS | ||||||
Region | 1-22 | Disordered | ||||
Sequence: MSTPRKAAGNNENTEVSEIRTP | ||||||
Region | 65-79 | Required for interaction with SPC24-SPC25 | ||||
Sequence: EVRSFLQDLSQVLAR | ||||||
Region | 103-132 | Disordered | ||||
Sequence: EESQPEENELLRSRSEKLTDNNIGNETQPD | ||||||
Region | 193-255 | Disordered | ||||
Sequence: PSIGMDQVDEPPVRDPVPISITQQEEPLSEDLPSDDKEETEEAENEDYSFENTSDENLDDIGN | ||||||
Compositional bias | 221-250 | Acidic residues | ||||
Sequence: SEDLPSDDKEETEEAENEDYSFENTSDENL |
Sequence similarities
Belongs to the CENP-T/CNN1 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length361
- Mass (Da)41,313
- Last updated1995-11-01 v1
- Checksum48CEEC087A056D42
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-17 | Polar residues | ||||
Sequence: MSTPRKAAGNNENTEVS | ||||||
Sequence conflict | 8 | in Ref. 2; AAT92741 | ||||
Sequence: A → T | ||||||
Compositional bias | 221-250 | Acidic residues | ||||
Sequence: SEDLPSDDKEETEEAENEDYSFENTSDENL |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
D50617 EMBL· GenBank· DDBJ | BAA09285.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY692722 EMBL· GenBank· DDBJ | AAT92741.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006940 EMBL· GenBank· DDBJ | DAA12489.1 EMBL· GenBank· DDBJ | Genomic DNA |