P43598 · IGD1_YEAST
- ProteinInhibitor of glycogen debranching 1
- GeneIGD1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids195 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Acts as an inhibitor of GDB1, enhancing the ability of cells to store glucose as glycogen.
Miscellaneous
Present with 639 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | enzyme inhibitor activity | |
Biological Process | glycogen biosynthetic process | |
Biological Process | negative regulation of glycogen catabolic process |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameInhibitor of glycogen debranching 1
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP43598
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000202687 | 1-195 | Inhibitor of glycogen debranching 1 | |||
Sequence: MTDPHLNTPQVSTSPTFERSQDFLNIDEPPCAQETPSVSTFNLPGPSAPAQSVDKPVPMIRRRSTNYMDALNSREQARERESSIGEHAPGAERRSSGPMDFQNTIHNMQYRTTNDSDLSHAGVDMGDSISHTPICSRAGNRPIFKNSYLDNNSNGNSARVPHGSPPQLGTRRKSSFKYEDFKKDIYNQLHMFGEK | ||||||
Modified residue | 64 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 65 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 95 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 96 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 132 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 164 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Induction
Expression increases during wine fermentation.
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-21 | Polar residues | ||||
Sequence: MTDPHLNTPQVSTSPTFERSQ | ||||||
Region | 1-101 | Disordered | ||||
Sequence: MTDPHLNTPQVSTSPTFERSQDFLNIDEPPCAQETPSVSTFNLPGPSAPAQSVDKPVPMIRRRSTNYMDALNSREQARERESSIGEHAPGAERRSSGPMDF | ||||||
Compositional bias | 32-47 | Polar residues | ||||
Sequence: AQETPSVSTFNLPGPS | ||||||
Compositional bias | 73-88 | Basic and acidic residues | ||||
Sequence: SREQARERESSIGEHA | ||||||
Compositional bias | 146-171 | Polar residues | ||||
Sequence: NSYLDNNSNGNSARVPHGSPPQLGTR | ||||||
Region | 146-175 | Disordered | ||||
Sequence: NSYLDNNSNGNSARVPHGSPPQLGTRRKSS |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length195
- Mass (Da)21,783
- Last updated1995-11-01 v1
- Checksum72A5C94EB59B4AB1
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-21 | Polar residues | ||||
Sequence: MTDPHLNTPQVSTSPTFERSQ | ||||||
Compositional bias | 32-47 | Polar residues | ||||
Sequence: AQETPSVSTFNLPGPS | ||||||
Compositional bias | 73-88 | Basic and acidic residues | ||||
Sequence: SREQARERESSIGEHA | ||||||
Compositional bias | 146-171 | Polar residues | ||||
Sequence: NSYLDNNSNGNSARVPHGSPPQLGTR |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
D50617 EMBL· GenBank· DDBJ | BAA09256.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY558470 EMBL· GenBank· DDBJ | AAS56796.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006940 EMBL· GenBank· DDBJ | DAA12458.1 EMBL· GenBank· DDBJ | Genomic DNA |