P43431 · IL12A_MOUSE
- ProteinInterleukin-12 subunit alpha
- GeneIl12a
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids215 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Heterodimerizes with IL12B to form the IL-12 cytokine or with EBI3/IL27B to form the IL-35 cytokine. IL-12 is primarily produced by professional antigen-presenting cells (APCs) such as B-cells and dendritic cells (DCs) as well as macrophages and granulocytes and regulates T-cell and natural killer-cell responses, induces the production of interferon-gamma (IFN-gamma), favors the differentiation of T-helper 1 (Th1) cells and is an important link between innate resistance and adaptive immunity (PubMed:8766560).
Mechanistically, exerts its biological effects through a receptor composed of IL12R1 and IL12R2 subunits. Binding to the receptor results in the rapid tyrosine phosphorylation of a number of cellular substrates including the JAK family kinases TYK2 and JAK2. In turn, recruited STAT4 gets phosphorylated and translocates to the nucleus where it regulates cytokine/growth factor responsive genes (By similarity).
As part of IL-35, plays essential roles in maintaining the immune homeostasis of the liver microenvironment and functions also as an immune-suppressive cytokine (PubMed:18033300, PubMed:30197594).
Mediates biological events through unconventional receptors composed of IL12RB2 and gp130/IL6ST heterodimers or homodimers. Signaling requires the transcription factors STAT1 and STAT4, which form a unique heterodimer that binds to distinct DNA sites (By similarity).
Mechanistically, exerts its biological effects through a receptor composed of IL12R1 and IL12R2 subunits. Binding to the receptor results in the rapid tyrosine phosphorylation of a number of cellular substrates including the JAK family kinases TYK2 and JAK2. In turn, recruited STAT4 gets phosphorylated and translocates to the nucleus where it regulates cytokine/growth factor responsive genes (By similarity).
As part of IL-35, plays essential roles in maintaining the immune homeostasis of the liver microenvironment and functions also as an immune-suppressive cytokine (PubMed:18033300, PubMed:30197594).
Mediates biological events through unconventional receptors composed of IL12RB2 and gp130/IL6ST heterodimers or homodimers. Signaling requires the transcription factors STAT1 and STAT4, which form a unique heterodimer that binds to distinct DNA sites (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell surface | |
Cellular Component | cytoplasm | |
Cellular Component | endoplasmic reticulum lumen | |
Cellular Component | endosome lumen | |
Cellular Component | extracellular region | |
Cellular Component | extracellular space | |
Cellular Component | Golgi lumen | |
Cellular Component | interleukin-12 complex | |
Molecular Function | cytokine activity | |
Molecular Function | growth factor activity | |
Molecular Function | interleukin-12 beta subunit binding | |
Molecular Function | interleukin-12 receptor binding | |
Biological Process | cell population proliferation | |
Biological Process | cellular response to lipopolysaccharide | |
Biological Process | defense response to protozoan | |
Biological Process | immune response | |
Biological Process | positive regulation of T cell differentiation | |
Biological Process | positive regulation of T cell proliferation | |
Biological Process | positive regulation of type II interferon production | |
Biological Process | T cell proliferation | |
Biological Process | T-helper 1 cell activation |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameInterleukin-12 subunit alpha
- Short namesIL-12A
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP43431
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Deletion mutant mice display normal development (PubMed:8766560).
However, they are unable to restrict the progression of Leishmania major infection with strong parasite load in lymphoid tissues observed (PubMed:8766560).
In addition, regulatory T-cells are functionally defective and mice are unable to control colitis (resembling inflammatory bowel disease, IBD) (PubMed:18033300).
However, they are unable to restrict the progression of Leishmania major infection with strong parasite load in lymphoid tissues observed (PubMed:8766560).
In addition, regulatory T-cells are functionally defective and mice are unable to control colitis (resembling inflammatory bowel disease, IBD) (PubMed:18033300).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 21 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MCQSRYLLFLATLALLNHLSLA | ||||||
Chain | PRO_0000015608 | 23-215 | Interleukin-12 subunit alpha | |||
Sequence: RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA | ||||||
Disulfide bond | 33↔106 | |||||
Sequence: CLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSC | ||||||
Disulfide bond | 60↔192 | |||||
Sequence: CTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLC | ||||||
Disulfide bond | 81↔119 | |||||
Sequence: CLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLC | ||||||
Glycosylation | 89 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 92 | Interchain (with C-197 in IL12B) | ||||
Sequence: C |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Heterodimer with IL12B; disulfide-linked (PubMed:1350290).
This heterodimer is known as interleukin IL-12 (PubMed:1350290).
Heterodimer with EBI3/IL27B; not disulfide-linked (By similarity).
This heterodimer is known as interleukin IL-35 (By similarity).
Interacts with NBR1; this interaction promotes IL-12 secretion (PubMed:34374750).
This heterodimer is known as interleukin IL-12 (PubMed:1350290).
Heterodimer with EBI3/IL27B; not disulfide-linked (By similarity).
This heterodimer is known as interleukin IL-35 (By similarity).
Interacts with NBR1; this interaction promotes IL-12 secretion (PubMed:34374750).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P43431 | Ebi3 O35228 | 2 | EBI-3862959, EBI-3862967 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length215
- Mass (Da)24,179
- Last updated1995-11-01 v1
- Checksum56845B9B66D35A53
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F8WI71 | F8WI71_MOUSE | Il12a | 236 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M86672 EMBL· GenBank· DDBJ | AAA39292.1 EMBL· GenBank· DDBJ | mRNA | ||
S82419 EMBL· GenBank· DDBJ | AAB37382.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S82412 EMBL· GenBank· DDBJ | AAB37382.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S82414 EMBL· GenBank· DDBJ | AAB37382.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S82417 EMBL· GenBank· DDBJ | AAB37382.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S82418 EMBL· GenBank· DDBJ | AAB37382.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
D63334 EMBL· GenBank· DDBJ | BAA09647.1 EMBL· GenBank· DDBJ | Genomic DNA |